5AQP: Heat shock cognate 71 kda protein
Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site residues. Determined by X-ray diffraction at 2.08 Å resolution. Released 5 Oct 2016.
- Method
- X-ray diffraction
- Resolution
- 2.08 Å
- Organism
- HOMO SAPIENS
- Chains
- 6
- Atoms
- 11,954
- Mol. weight
- 170.12 kDa
- Ligands
- 1LQ
- Released
- 5 Oct 2016
Explore 5AQP in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5AQP contains 65 α-helices and 65 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 19 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1-2 | 2 | |
| β-strand | 3 | 1 | 1 |
| β-strand | 7-10 | 4 | 2 |
| β-strand | 15-16 | 2 | 3 |
| β-strand | 17-22 | 6 | 2 |
| β-strand | 25-28 | 4 | 2 |
| α-helix | 29-30 | 2 | |
| β-strand | 38-39 | 2 | 3 |
| β-strand | 42-44 | 3 | 4 |
| β-strand | 49-51 | 3 | 4 |
| α-helix | 53-57 | 5 | |
| β-strand | 66-67 | 2 | 4 |
| α-helix | 70-72 | 3 | |
| α-helix | 81-87 | 7 | |
| β-strand | 93-97 | 5 | 5 |
| β-strand | 100-107 | 8 | 5 |
| β-strand | 110-114 | 5 | 5 |
| α-helix | 116-135 | 20 | |
| β-strand | 138 | 1 | 1 |
| β-strand | 141-146 | 6 | 2 |
| α-helix | 152-164 | 13 | |
| β-strand | 168-174 | 7 | 2 |
| α-helix | 175-182 | 8 | |
| α-helix | 185-187 | 3 | |
| β-strand | 193-201 | 9 | 6 |
| β-strand | 204-213 | 10 | 6 |
| β-strand | 216-225 | 10 | 6 |
| α-helix | 230-249 | 20 | |
| α-helix | 257-273 | 17 | |
| β-strand | 279-288 | 10 | 7 |
| β-strand | 291-298 | 8 | 7 |
| α-helix | 299-305 | 7 | |
| α-helix | 307-311 | 5 | |
| α-helix | 314-323 | 10 | |
| α-helix | 328-330 | 3 | |
| β-strand | 333-337 | 5 | 6 |
| α-helix | 339-342 | 4 | |
| α-helix | 344-353 | 10 | |
| α-helix | 357-359 | 3 | |
| β-strand | 360 | 1 | 6 |
| α-helix | 368-379 | 12 | |
Chain B: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 153-187 | 35 | |
| α-helix | 193-201 | 9 | |
| α-helix | 204-221 | 18 | |
| α-helix | 231-256 | 26 | |
Chain C: 18 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3 | 1 | 8 |
| β-strand | 7-10 | 4 | 9 |
| β-strand | 15-16 | 2 | 10 |
| β-strand | 17-22 | 6 | 9 |
| β-strand | 25-28 | 4 | 9 |
| α-helix | 29-30 | 2 | |
| β-strand | 38-39 | 2 | 10 |
| β-strand | 42-44 | 3 | 11 |
| β-strand | 49-51 | 3 | 11 |
| α-helix | 53-57 | 5 | |
| β-strand | 66-67 | 2 | 11 |
| α-helix | 70-72 | 3 | |
| α-helix | 81-87 | 7 | |
| β-strand | 93-97 | 5 | 12 |
| β-strand | 100-107 | 8 | 12 |
| β-strand | 110-114 | 5 | 12 |
| α-helix | 116-135 | 20 | |
| β-strand | 138 | 1 | 8 |
| β-strand | 141-146 | 6 | 9 |
| α-helix | 152-164 | 13 | |
| β-strand | 168-174 | 7 | 9 |
| α-helix | 175-182 | 8 | |
| α-helix | 185-187 | 3 | |
| β-strand | 193-201 | 9 | 13 |
| β-strand | 204-213 | 10 | 13 |
| β-strand | 216-225 | 10 | 13 |
| α-helix | 230-249 | 20 | |
| α-helix | 257-273 | 17 | |
| β-strand | 279-288 | 10 | 14 |
| β-strand | 291-298 | 8 | 14 |
| α-helix | 299-305 | 7 | |
| α-helix | 307-311 | 5 | |
| α-helix | 314-323 | 10 | |
| α-helix | 328-330 | 3 | |
| β-strand | 333-337 | 5 | 13 |
| α-helix | 339-342 | 4 | |
| α-helix | 344-353 | 10 | |
| α-helix | 357-359 | 3 | |
| β-strand | 360 | 1 | 13 |
| α-helix | 368-379 | 12 | |
Chain D: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 153-187 | 35 | |
| α-helix | 193-201 | 9 | |
| α-helix | 204-221 | 18 | |
| α-helix | 231-257 | 27 | |
Chain E: 16 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3 | 1 | 15 |
| β-strand | 7-11 | 5 | 16 |
| β-strand | 15-22 | 8 | 16 |
| β-strand | 25-28 | 4 | 16 |
| α-helix | 29-30 | 2 | |
| β-strand | 38-39 | 2 | 16 |
| β-strand | 42-44 | 3 | 17 |
| β-strand | 49-51 | 3 | 17 |
| α-helix | 53-57 | 5 | |
| β-strand | 66-67 | 2 | 17 |
| α-helix | 70-72 | 3 | |
| α-helix | 81-87 | 7 | |
| β-strand | 93-97 | 5 | 18 |
| β-strand | 100-107 | 8 | 18 |
| β-strand | 110-114 | 5 | 18 |
| α-helix | 116-135 | 20 | |
| β-strand | 138 | 1 | 15 |
| β-strand | 141-146 | 6 | 16 |
| α-helix | 152-164 | 13 | |
| β-strand | 168-174 | 7 | 16 |
| α-helix | 175-182 | 8 | |
| β-strand | 193-201 | 9 | 19 |
| β-strand | 204-213 | 10 | 19 |
| β-strand | 216-225 | 10 | 19 |
| α-helix | 230-249 | 20 | |
| α-helix | 257-273 | 17 | |
| β-strand | 279-288 | 10 | 20 |
| β-strand | 291-298 | 8 | 20 |
| α-helix | 299-312 | 14 | |
| α-helix | 314-323 | 10 | |
| α-helix | 328-330 | 3 | |
| β-strand | 333-337 | 5 | 19 |
| α-helix | 339-342 | 4 | |
| α-helix | 344-353 | 10 | |
| α-helix | 357-359 | 3 | |
| β-strand | 360 | 1 | 19 |
| α-helix | 368-379 | 12 | |
Chain F: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 153-188 | 36 | |
| α-helix | 193-202 | 10 | |
| α-helix | 204-221 | 18 | |
| α-helix | 231-256 | 26 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Heat shock cognate 71 kda protein | A, C, E | protein | 386 | HOMO SAPIENS | P11142 (AlphaFold model) |
| Bag family molecular chaperone regulator 1 | B, D, F | protein | 118 | HOMO SAPIENS | Q99933 (AlphaFold model) |
Sequence of entity 1 (A, C, E), FASTA
>5AQP_1 HEAT SHOCK COGNATE 71 KDA PROTEIN (chains A, C, E)
GPLGSMSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA
KNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFY
PEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINE
PTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDN
RMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYT
SITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFN
GKELNKSINPDEAVAYGAAVQAAILS
Sequence of entity 2 (B, D, F), FASTA
>5AQP_2 BAG FAMILY MOLECULAR CHAPERONE REGULATOR 1 (chains B, D, F)
GPLGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDR
RVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETE
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| 1LQ | quinazolin-4-amine | C8 H7 N3 | 3 |
Water and common crystallization additives (GOL, DMS, TRS) are not listed.
Primary citation
A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms. Jones, A.M., Westwood, I.M., Osborne, J.D. et al. Sci Rep (2016) 6:34701-34701. DOI 10.1038/srep34701 · PubMed
Other PDB entries of the same protein (UniProt P11142 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5AQM 1.63 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
- 4H5R 1.64 Å, HSC70 NBD with Na, Cl and glycerol
- 5AQL 1.69 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
- 4H5V 1.75 Å, HSC70 NBD with Mg
- 5AQV 1.75 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
- 6B1N 1.8 Å, Disrupted hydrogen bond network impairs ATPase activity in an Hsc70 cysteine mutant
- 3AGY 1.85 Å, Crystal structure of human Hsp40 Hdj1 peptide-binding domain complexed with a C-terminal…
- 6ZYJ 1.85 Å, Crystal structure of Hsc70 ATPase domain in complex with ADP and calcium
- 4H5N 1.86 Å, HSC70 NBD with PO4, Na, Cl
- 5AQF 1.88 Å, Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site…
- 3LDQ 1.9 Å, Crystal structure of HSC70/BAG1 in complex with small molecule inhibitor
- 4H5T 1.9 Å, HSC70 NBD with ADP and Mg
Browse structure collections
About this viewer
MolViewer shows 5AQP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.