5CM4: Human Frizzled 4 Cysteine-Rich Domain

Crystal structure of human Frizzled 4 Cysteine-Rich Domain (CRD). Determined by X-ray diffraction at 2.4 Å resolution. Released 12 Aug 2015.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,998
Mol. weight: 29.38 kDa
Ligands: NAG
Released: 12 Aug 2015

Explore 5CM4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CM4 contains 16 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	46-47	2	1
α-helix	48	1
α-helix	51-53	3
β-strand	60-61	2	1
α-helix	72-79	8
α-helix	80-82	3
α-helix	83-88	6
α-helix	94-102	9
β-strand	105-107	3	1
β-strand	110-114	5	1
β-strand	116	1	2
α-helix	118-134	17
α-helix	141-143	3
α-helix	145-147	3
β-strand	159	1	2

Chain B: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	46-47	2	3
α-helix	51-53	3
β-strand	60-61	2	3
α-helix	72-80	9
α-helix	83-88	6
α-helix	94-102	9
β-strand	105-107	3	3
β-strand	110-114	5	3
β-strand	116	1	4
α-helix	118-134	17
α-helix	141-143	3
α-helix	145-147	3
β-strand	159	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Frizzled-4	A, B	protein	125	Homo sapiens	Q9ULV1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5CM4_1 Frizzled-4 (chains A, B)
EEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLC
SVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCM
EGPGD

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Primary citation

Structural basis of the Norrin-Frizzled 4 interaction. Shen, G., Ke, J., Wang, Z. et al. Cell Res (2015) 25:1078-1081. DOI 10.1038/cr.2015.92 · PubMed

Other PDB entries of the same protein (UniProt Q9ULV1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BPB 2.2 Å, Crystal structure of the cysteine-rich domain of human Frizzled 4 - Crystal Form I
5BQE 2.3 Å, Crystal structure of Norrin in complex with the cysteine-rich domain of Frizzled 4…
5BPQ 2.4 Å, Crystal structure of the cysteine-rich domain of human Frizzled 4 - Crystal Form II
6BD4 2.4 Å, Crystal structure of human apo-Frizzled4 receptor
5UWG 2.56 Å, The crystal structure of Fz4-CRD in complex with palmitoleic acid
5BQC 3.0 Å, Crystal structure of Norrin in complex with the cysteine-rich domain of Frizzled 4 and…
6NE1 3.01 Å, Designed repeat protein in complex with Fz4
8WMA 3.47 Å, Fzd4/DEP complex (local refined)
8WM9 3.53 Å, Fzd4/DEP complex
5CL1 3.8 Å, Complex structure of Norrin with human Frizzled 4

Browse structure collections

About this viewer

MolViewer shows 5CM4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.