5CTR: PDB entry 5CTR

Crystal structure of human SART3 HAT-C domain-human USP4 DUSP-UBL domain complex. Determined by X-ray diffraction at 3.01 Å resolution. Released 27 Apr 2016.

Method: X-ray diffraction
Resolution: 3.01 Å
Organism: Homo sapiens
Chains: 4
Atoms: 8,577
Mol. weight: 133.86 kDa
Released: 27 Apr 2016

Explore 5CTR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CTR contains 55 α-helices and 33 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 0 β-strands

Element	Residues	Length
α-helix	281-304	24
α-helix	310-323	14
α-helix	326-339	14
α-helix	344-353	10
α-helix	354-358	5
α-helix	361-374	14
α-helix	379-391	13
α-helix	396-408	13
α-helix	414-429	16
α-helix	440-455	16
α-helix	456-460	5
α-helix	461-464	4
α-helix	473-480	8
α-helix	481-485	5
α-helix	489-499	11
α-helix	500-504	5
α-helix	508-521	14
α-helix	524-537	14
α-helix	542-556	15
α-helix	559-585	27

Chain B: 19 helices, 0 β-strands

Element	Residues	Length
α-helix	281-294	14
α-helix	296-304	9
α-helix	310-323	14
α-helix	326-339	14
α-helix	344-353	10
α-helix	354-358	5
α-helix	361-374	14
α-helix	379-391	13
α-helix	396-407	12
α-helix	414-430	17
α-helix	440-455	16
α-helix	456-460	5
α-helix	461-464	4
α-helix	473-484	12
α-helix	489-501	13
α-helix	508-521	14
α-helix	524-537	14
α-helix	542-556	15
α-helix	559-582	24

Chain C: 8 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	13-20	8
α-helix	21-23	3
β-strand	32-38	7	1
α-helix	39-48	10
α-helix	62-64	3
β-strand	69	1	2
β-strand	75-77	3	3
β-strand	82-83	2	3
α-helix	84	1
β-strand	93-97	5	1
α-helix	98-108	11
β-strand	110	1	2
β-strand	118-124	7	1
β-strand	130-133	4	1
β-strand	140-143	4	4
β-strand	151-154	4	4
β-strand	161	1	5
α-helix	162-172	11
β-strand	183	1	6
β-strand	184-185	2	4
β-strand	195	1	6
β-strand	201	1	5
α-helix	207-208	2
β-strand	213-214	2	4

Chain D: 8 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	13-20	8
β-strand	33-38	6	7
α-helix	39-49	11
α-helix	62-64	3
β-strand	69	1	8
α-helix	72-74	3
β-strand	75-77	3	9
β-strand	82-83	2	9
α-helix	84	1
β-strand	89	1	7
β-strand	93-96	4	7
α-helix	98-107	10
β-strand	110	1	8
α-helix	114-116	3
β-strand	118-120	3	7
β-strand	121-123	3	10
β-strand	131-133	3	10
β-strand	138-144	7	11
β-strand	147-156	10	11
β-strand	161	1	12
α-helix	162-172	11
β-strand	182-185	4	11
β-strand	193-195	3	11
β-strand	201	1	12
β-strand	212-216	5	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Squamous cell carcinoma antigen recognized by T-cells 3	A, B	protein	338	Homo sapiens	Q15020 (AlphaFold model)
Ubiquitin carboxyl-terminal hydrolase 4	C, D	protein	233	Homo sapiens	Q13107 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5CTR_1 Squamous cell carcinoma antigen recognized by T-cells 3 (chains A, B)
GSHMPESVIQNYNKALQQLEKYKPYEEALLQAEAPRLAEYQAYIDFEMKIGDPARIQLIF
ERALVENCLVPDLWIRYSQYLDRQLKVKDLVLSVHNRAIRNCPWTVALWSRYLLAMERHG
VDHQVISVTFEKALNAGFIQATDYVEIWQAYLDYLRRRVDFKQDSSKELEELRAAFTRAL
EYLKQEVEERFNESGDPSCVIMQNWARIEARLCNNMQKARELWDSIMTRGNAKYANMWLE
YYNLERAHGDTQHCRKALHRAVQCTSDYPEHVCEVLLTMERTEGSLEDWDIAVQKTETRL
ARVNEQRMKAAEKEAALVQQEEEKAEQRKRARAEKKAL

Sequence of entity 2 (C, D), FASTA

>5CTR_2 Ubiquitin carboxyl-terminal hydrolase 4 (chains C, D)
GSHMAEGGGCRERPDAETQKSELGPLMRTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMY
NVGEHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPI
VRKVVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPA
ERETRLWNKYMSNTYEQLSKLDNTVQDAGLYQGQVLVIEPQNEDGTWPRQTLQ

Primary citation

Structural basis for recruiting and shuttling of the spliceosomal deubiquitinase USP4 by SART3. Park, J.K., Das, T., Song, E.J. et al. Nucleic Acids Res (2016) 44:5424-5437. DOI 10.1093/nar/gkw218 · PubMed

Other PDB entries of the same protein (UniProt Q15020 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CTT 1.7 Å, Crystal structure of human SART3/TIP110 NLS-mouse importin alpha complex
5JJX 2.0 Å, Crystal structure of the HAT domain of sart3
5CTQ 2.6 Å, Crystal structure of human SART3/TIP110 half-a TPR (HAT) domain
5JJW 3.01 Å, Crystal structure of the HAT domain of sart3 in complex with USP15 DUSP-UBL domain
5JPZ 3.04 Å, Crystal structure of HAT domain of human Squamous Cell Carcinoma Antigen Recognized By T…
2DO4 Solution structure of the RNA binding domain of squamous cell carcinoma antigen…
7XX8 Solution structure of RRM1 of Human SART3
7XX9 Solution structure of RRM2 of Human SART3

Browse structure collections

About this viewer

MolViewer shows 5CTR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.