Crystal structure of rtx domain block V of adenylate cyclase toxin from bordetella pertussis. Determined by X-ray diffraction at 1.45 Å resolution. Released 2 Sept 2015.
Explore 5CXL in 3D Show helices and sheets RCSB PDB PDBe
5CXL contains 6 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1535-1537 | 3 | 1 |
| β-strand | 1544-1546 | 3 | 2 |
| β-strand | 1553-1555 | 3 | 1 |
| β-strand | 1562-1564 | 3 | 2 |
| β-strand | 1571-1573 | 3 | 1 |
| β-strand | 1580-1584 | 5 | 2 |
| β-strand | 1589-1593 | 5 | 1 |
| β-strand | 1598-1603 | 6 | 2 |
| β-strand | 1610-1614 | 5 | 1 |
| α-helix | 1617-1619 | 3 | |
| β-strand | 1620-1625 | 6 | 2 |
| β-strand | 1628-1633 | 6 | 2 |
| β-strand | 1639-1642 | 4 | 2 |
| α-helix | 1649-1651 | 3 | |
| β-strand | 1655-1658 | 4 | 1 |
| β-strand | 1661-1664 | 4 | 1 |
| α-helix | 1665-1675 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1535-1537 | 3 | 3 |
| β-strand | 1544-1546 | 3 | 4 |
| β-strand | 1553-1555 | 3 | 3 |
| β-strand | 1562-1564 | 3 | 4 |
| β-strand | 1571-1573 | 3 | 3 |
| β-strand | 1580-1584 | 5 | 4 |
| β-strand | 1589-1592 | 4 | 3 |
| β-strand | 1598-1603 | 6 | 4 |
| β-strand | 1610-1613 | 4 | 3 |
| α-helix | 1617-1619 | 3 | |
| β-strand | 1620-1625 | 6 | 4 |
| β-strand | 1628-1633 | 6 | 4 |
| β-strand | 1639-1642 | 4 | 4 |
| α-helix | 1649-1651 | 3 | |
| β-strand | 1655-1657 | 3 | 3 |
| β-strand | 1662-1663 | 2 | 3 |
| α-helix | 1665-1675 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Bifunctional hemolysin/adenylate cyclase | A, B | protein | 153 | Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) | P0DKX7 (AlphaFold model) |
>5CXL_1 Bifunctional hemolysin/adenylate cyclase (chains A, B) GSARDDVLIGDAGANVLNGLAGNDVLSGGAGDDVLLGDEGSDLLSGDAGNDDLFGGQGDD TYLFGVGYGHDTIYESGGGHDTIRINAGADQLWFARQGNDLEIRILGTDDALTVHDWYRD ADHRVEIIHAANQAVDQAGIEKLVEAMAQYPDP
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 16 |
Water and common crystallization additives (NO3) are not listed.
Calcium-Driven Folding of RTX Domain beta-Rolls Ratchets Translocation of RTX Proteins through Type I Secretion Ducts. Bumba, L., Masin, J., Macek, P. et al. Mol Cell (2016) 62:47-62. DOI 10.1016/j.molcel.2016.03.018 · PubMed
Other PDB entries of the same protein (UniProt P0DKX7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5CXL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.