5DC0: Monobody GG3/ABL1 SH2 domain complex

Crystal structure of monobody GG3/ABL1 SH2 domain complex. Determined by X-ray diffraction at 2.23 Å resolution. Released 2 Mar 2016.

Method: X-ray diffraction
Resolution: 2.23 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,518
Mol. weight: 23.44 kDa
Released: 2 Mar 2016

Explore 5DC0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5DC0 contains 7 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	6-13	8	1
β-strand	18-23	6	1
α-helix	24-25	2
β-strand	31-38	8	2
α-helix	44-45	2
β-strand	46-51	6	2
β-strand	56-59	4	1
α-helix	62-63	2
β-strand	67-75	9	2
α-helix	82-86	5
β-strand	87-92	6	2

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	147-150	4	3
α-helix	153-159	7
β-strand	167-172	6	3
β-strand	180-186	7	3
β-strand	189-194	6	3
β-strand	196-197	2	4
β-strand	203-204	2	4
β-strand	210-211	2	4
α-helix	214-221	8
β-strand	234-235	2	3
α-helix	236-237	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fibronectin	A	protein	93	Homo sapiens	P02751 (AlphaFold model)
Tyrosine-protein kinase ABL1	B	protein	121	Homo sapiens	P00519 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5DC0_1 Fibronectin (chains A)
VSDVPTKLEVVAATPTSLLISWDAPAVTVVHYVITYGETGGNSPVQEFTVPGSKSTATIS
GLSPGVDYTITVYALLSSSHWVYESPISINYRT

Sequence of entity 2 (B), FASTA

>5DC0_2 Tyrosine-protein kinase ABL1 (chains B)
PSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRV
YHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPN
Y

Primary citation

Allosteric Inhibition of Bcr-Abl Kinase by High Affinity Monobody Inhibitors Directed to the Src Homology 2 (SH2)-Kinase Interface. Wojcik, J., Lamontanara, A.J., Grabe, G. et al. J Biol Chem (2016) 291:8836-8847. DOI 10.1074/jbc.M115.707901 · PubMed

Other PDB entries of the same protein (UniProt P02751 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2CG7 1.2 Å, Second and third fibronectin type I module pair (crystal form II).
4LXO 1.42 Å, Crystal structure of 9,10Fn3-elegantin chimera
5DC4 1.48 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal a
2CG6 1.55 Å, Second and third fibronectin type I module pair (crystal form I).
5DC9 1.56 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal B
5N48 1.6 Å, Structure of Anticalin N9B in complex with extra-domain B of human oncofetal fibronectin
3CAL 1.7 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
3ZRZ 1.7 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…
6MFA 1.75 Å, Fragment of human fibronectin containing the 4th-7th type III domains
1FNA 1.8 Å, Crystal structure of the tenth type III cell adhesion module of human fibronectin
2RKY 1.8 Å, Crystal structure of the fourth and fifth fibronectin F1 modules in complex with a…
4PZ5 1.96 Å, Crystal structure of the second and third fibronectin F1 modules in complex with a…

Browse structure collections

About this viewer

MolViewer shows 5DC0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.