5DUI: Forkhead box protein O1

Identification of a new FoxO1 binding site that precludes CREB binding at the glucose-6-phosphatase catalytic subunit gene promoter. Determined by X-ray diffraction at 2.31 Å resolution. Released 21 Sept 2016.

Method: X-ray diffraction
Resolution: 2.31 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,274
Mol. weight: 37.77 kDa
Released: 21 Sept 2016

Explore 5DUI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5DUI contains 9 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	165-175	11
β-strand	180-181	2	1
α-helix	183-193	11
α-helix	195-197	3
α-helix	208-219	12
β-strand	223-226	4	1
α-helix	233-235	3
β-strand	236-239	4	1

Chain B: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	165-175	11
β-strand	180-181	2	2
α-helix	183-191	9
α-helix	209-219	11
β-strand	223-226	4	2
α-helix	235	1
β-strand	236-239	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Forkhead box protein O1	A, B	protein	111	Homo sapiens	Q12778 (AlphaFold model)
DNA (5'-d(tptptptpcptpaptptptptpapcpgptpapapaptpcp*a)-3')	C	DNA	21	Homo sapiens
DNA (5'-d(aptpgpaptptptpapcpgptpapapapaptpapgpapap*a)-3')	D	DNA	21	Homo sapiens

Sequence of entity 1 (A, B), FASTA

>5DUI_1 Forkhead box protein O1 (chains A, B)
GSKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAG
WKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDN

Sequence of entity 2 (C), FASTA

>5DUI_2 DNA (5'-D(*TP*TP*TP*TP*CP*TP*AP*TP*TP*TP*TP*AP*CP*GP*TP*AP*AP*AP*TP*CP*A)-3') (chains C)
TTTTCTATTTTACGTAAATCA

Sequence of entity 3 (D), FASTA

>5DUI_3 DNA (5'-D(*AP*TP*GP*AP*TP*TP*TP*AP*CP*GP*TP*AP*AP*AP*AP*TP*AP*GP*AP*AP*A)-3') (chains D)
ATGATTTACGTAAAATAGAAA

Primary citation

Crystal structures reveal a new and novel FoxO1 binding site within the human glucose-6-phosphatase catalytic subunit 1 gene promoter. Singh, P., Han, E.H., Endrizzi, J.A. et al. J Struct Biol (2017) 198:54-64. DOI 10.1016/j.jsb.2017.02.006 · PubMed

Other PDB entries of the same protein (UniProt Q12778 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8A62 1.6 Å, Small molecule stabilizer (compound 2) for FOXO1 and 14-3-3
8A65 1.6 Å, Small molecule stabilizer (compound 3) for FOXO1 and 14-3-3
6QZS 1.9 Å, 14-3-3 sigma in complex with FOXO1 pS256 peptide
3CO6 2.1 Å, Crystal Structure of FoxO1 DBD Bound to DBE1 DNA
4LG0 2.19 Å, Structure of a ternary FOXO1-ETS1 DNA complex
3COA 2.2 Å, Crystal Structure of FoxO1 DBD Bound to IRE DNA
6QZR 2.3 Å, 14-3-3 sigma in complex with FOXO1 pT24 peptide
3CO7 2.91 Å, Crystal Structure of FoxO1 DBD Bound to DBE2 DNA
6LBI 3.07 Å, Crystal Structure of FOXO1-DBD homodimer bound to a palindromic DNA sequence
6QVW Solution structure of the free FOXO1 DNA binding domain

Browse structure collections

About this viewer

MolViewer shows 5DUI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.