Re-refinement of the Crystal Structure of the Plexin-Semaphorin-Integrin Domain/Hybrid Domain/I-EGF1 Segment from the Human Integrin b2 Subunit. Determined by X-ray diffraction at 2.2 Å resolution. Released 2 Mar 2016.
Explore 5E6W in 3D Show helices and sheets RCSB PDB PDBe
5E6W contains 12 α-helices and 32 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-17 | 7 | |
| β-strand | 22-24 | 3 | 1 |
| α-helix | 27-29 | 3 | |
| α-helix | 36-39 | 4 | |
| β-strand | 40-41 | 2 | 1 |
| α-helix | 43-48 | 6 | |
| α-helix | 53-55 | 3 | |
| β-strand | 56-57 | 2 | 1 |
| β-strand | 62-66 | 5 | 2 |
| β-strand | 76-77 | 2 | 3 |
| β-strand | 80-85 | 6 | 2 |
| β-strand | 91-97 | 7 | 3 |
| β-strand | 99 | 1 | 4 |
| α-helix | 102 | 1 | |
| β-strand | 103-349 | 8 | 2 |
| β-strand | 356-363 | 8 | 3 |
| β-strand | 369-373 | 5 | 3 |
| β-strand | 376-381 | 6 | 2 |
| β-strand | 383 | 1 | 4 |
| β-strand | 387-395 | 9 | 3 |
| α-helix | 398-400 | 3 | |
| β-strand | 402-408 | 7 | 2 |
| β-strand | 414-421 | 8 | 2 |
| β-strand | 441-444 | 4 | 5 |
| β-strand | 447-450 | 4 | 5 |
| α-helix | 451 | 1 | |
| β-strand | 454-455 | 2 | 6 |
| β-strand | 461-462 | 2 | 6 |
| α-helix | 473-475 | 3 | |
| β-strand | 476 | 1 | 7 |
| β-strand | 483 | 1 | 7 |
| α-helix | 484-486 | 3 | |
| β-strand | 488-491 | 4 | 8 |
| β-strand | 494-497 | 4 | 8 |
| α-helix | 498-499 | 2 | |
| β-strand | 508 | 1 | 9 |
| β-strand | 514 | 1 | 9 |
| β-strand | 521-522 | 2 | 10 |
| β-strand | 525-526 | 2 | 10 |
| β-strand | 533-536 | 4 | 11 |
| β-strand | 539-542 | 4 | 11 |
| α-helix | 543 | 1 | |
| β-strand | 547 | 1 | 12 |
| β-strand | 553 | 1 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Integrin beta-2 | A | protein | 317 | Homo sapiens | P05107 (AlphaFold model) |
>5E6W_1 Integrin beta-2 (chains A) QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPT SLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKLSSRVFLDHNALPDTLKVT YDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQV LPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDN NSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCGK CRCHPGFEGSACQHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops. Sen, M., Springer, T.A. Proc Natl Acad Sci U S A (2016) 113:2940-2945. DOI 10.1073/pnas.1601379113 · PubMed
Other PDB entries of the same protein (UniProt P05107 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5E6W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.