Isoform-specific inhibition of SUMO-dependent protein-protein interactions. Determined by X-ray diffraction at 2.35 Å resolution. Released 16 Nov 2016.
Explore 5ELU in 3D Show helices and sheets RCSB PDB PDBe
5ELU contains 3 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 35-52 | 18 | |
| β-strand | 57-69 | 13 | 1 |
| β-strand | 76-87 | 12 | 1 |
| β-strand | 90-100 | 11 | 1 |
| α-helix | 105-107 | 3 | |
| β-strand | 113-120 | 8 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17-24 | 8 | 1 |
| β-strand | 29-35 | 7 | 1 |
| α-helix | 41-51 | 11 | |
| β-strand | 58-62 | 5 | 1 |
| β-strand | 65-66 | 2 | 1 |
| β-strand | 83-88 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| SUMO-Affirmer-S2B3 | A | protein | 118 | synthetic construct | |
| Small ubiquitin-related modifier 2 | B | protein | 77 | Homo sapiens | P61956 (AlphaFold model) |
>5ELU_1 SUMO-Affirmer-S2B3 (chains A) MASAATGVRAVPGNENSLEIEELARFAVDEHNKKENALLEFVRVVKAKEQVDLTRFPVTT MYYLTLEAKDGGKKKLYEAKVWVKGYLLEELKHNFKELQEFKPVGDAAAAHHHHHHHH
>5ELU_2 Small ubiquitin-related modifier 2 (chains B) MNNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDT PAQLEMEDEDTIDVFQQ
Generation of specific inhibitors of SUMO-1- and SUMO-2/3-mediated protein-protein interactions using Affimer (Adhiron) technology. Hughes, D.J., Tiede, C., Penswick, N. et al. Sci Signal (2017) 10. DOI 10.1126/scisignal.aaj2005 · PubMed
Other PDB entries of the same protein (UniProt P61956 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5ELU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.