5F67: Inactivation-no-after-potential D protein

An exquisitely specific PDZ/target recognition revealed by the structure of INAD PDZ3 in complex with TRP channel tail. Determined by X-ray diffraction at 1.76 Å resolution. Released 24 Feb 2016.

Method: X-ray diffraction
Resolution: 1.76 Å
Organism: Drosophila melanogaster
Chains: 4
Atoms: 1,993
Mol. weight: 27.25 kDa
Released: 24 Feb 2016

Explore 5F67 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5F67 contains 6 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	357-360	4
β-strand	365-370	6	1
β-strand	372	1	2
β-strand	374	1	2
β-strand	377-384	8	1
β-strand	388-396	9	1
β-strand	397	1	3
α-helix	401-404	4
β-strand	412-416	5	1
β-strand	419-420	2	1
α-helix	426-435	10
β-strand	439-445	7	1

Chains C and D: 0 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	1262-1263	2	4
β-strand	1264	1	3
β-strand	1270-1271	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Inactivation-no-after-potential D protein	A, B	protein	108	Drosophila melanogaster	Q24008 (AlphaFold model)
TRP C terminal Tail	C, D	protein	19	Drosophila melanogaster	P19334 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5F67_1 Inactivation-no-after-potential D protein (chains A, B)
GPGSKKFPTASDETKFIFDQFPKARTVQVRKEGFLGIMVIYGKHAEVGSGIFISDLREGS
NAELAGVKVGDMLLAVNQDVTLESNYDDATGLLKRAEGVVTMILLTLK

Sequence of entity 2 (C, D), FASTA

>5F67_2 TRP C terminal Tail (chains C, D)
GPGSRGKSTVTGRMISGWL

Primary citation

An Exquisitely Specific PDZ/Target Recognition Revealed by the Structure of INAD PDZ3 in Complex with TRP Channel Tail. Ye, F., Liu, W., Shang, Y. et al. Structure (2016) 24:383-391. DOI 10.1016/j.str.2015.12.013 · PubMed

Other PDB entries of the same protein (UniProt Q24008 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QKV 1.55 Å, Crystal Structure of the C645S Mutant of the 5th PDZ Domain of InaD
1IHJ 1.8 Å, Crystal Structure of the N-terminal PDZ domain of InaD in complex with a NorpA…
2QKT 2.05 Å, Crystal Structure of the 5th PDZ domain of InaD
2QKU 2.2 Å, The 5th PDZ Domain of InaD in 10mM DTT
3R0H 2.6 Å, Structure of INAD PDZ45 in complex with NG2 peptide
6IRE 3.25 Å, Complex structure of INAD PDZ45 and NORPA CC-PBM
2LA8 Solution structure of INAD PDZ5 complexed with Kon-tiki peptide

Browse structure collections

About this viewer

MolViewer shows 5F67 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.