5FHT: HtrA2 protease mutant V226K

HtrA2 protease mutant V226K. Determined by X-ray diffraction at 1.95 Å resolution. Released 7 Sept 2016.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,499
Mol. weight: 36.53 kDa
Released: 7 Sept 2016

Explore 5FHT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FHT contains 15 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	10-14	5
α-helix	16-24	9
α-helix	25-27	3
β-strand	28-37	10	1
β-strand	42-55	14	1
β-strand	59-62	4	1
α-helix	64-67	4
β-strand	72-76	5	1
β-strand	82-91	10	1
β-strand	96-100	5	1
α-helix	106-108	3
β-strand	112	1	2
α-helix	115-117	3
α-helix	118-119	2
β-strand	123-126	4	2
β-strand	138-142	5	2
α-helix	158-159	2
α-helix	161	1
β-strand	162-164	3	2
β-strand	176-179	4	2
β-strand	184-193	10	2
β-strand	196-201	6	2
α-helix	202-210	9
β-strand	226-228	3	3
β-strand	231-235	5	4
α-helix	238-247	10
β-strand	258-263	6	4
α-helix	268-272	5
β-strand	279-283	5	4
β-strand	286-287	2	4
α-helix	288	1
α-helix	291-300	10
β-strand	304-310	7	4
β-strand	313-319	7	4
α-helix	321	1
β-strand	322-324	3	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine protease HTRA2, mitochondrial	A	protein	334	Homo sapiens	O43464 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5FHT_1 Serine protease HTRA2, mitochondrial (chains A)
MAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGL
IVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPKADIATLRIQTKEPLPTLPLGRSADVR
QGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNAGGPLVN
LDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPS
ILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVR
TQSQLAVQIRRGRETLTLYVTPEVTELEHHHHHH

Primary citation

Distinct 3D Architecture and Dynamics of the Human HtrA2(Omi) Protease and Its Mutated Variants. Gieldon, A., Zurawa-Janicka, D., Jarzab, M. et al. PLoS One (2016) 11:e0161526-e0161526. DOI 10.1371/journal.pone.0161526 · PubMed

Other PDB entries of the same protein (UniProt O43464 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M3N 1.65 Å, HTRA2 wild-type structure
5TO1 1.69 Å, HtrA2 exposed (L266R, F303A) mutant
5M3O 1.7 Å, HTRA2 A141S mutant structure
5TNY 1.7 Å, HTRA2 G399S mutant
5TNZ 1.75 Å, HtrA2 S142D mutant
5TO0 1.9 Å, HTRA2 S276C mutant
1LCY 2.0 Å, Crystal Structure of the Mitochondrial Serine Protease HtrA2
5WYN 2.05 Å, HtrA2 Pathogenic Mutant
2PZD 2.75 Å, Crystal Structure of the HtrA2/Omi PDZ Domain Bound to a Phage-Derived Ligand (WTMFWV)
8E2K 3.21 Å, Cryo-EM structure of BIRC6/HtrA2-S306A
7VGE 4.0 Å, Structure of the PDZ deleted variant of HtrA2 protease (S306A)
8AUK 6.2 Å, Cryo-EM structure of human BIRC6 in complex with HTRA2.

Browse structure collections

About this viewer

MolViewer shows 5FHT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.