Crystal structure of a truncated human cytosolic methionyl-tRNA synthetase. Determined by X-ray diffraction at 2.01 Å resolution. Released 12 Jul 2017.
Explore 5GL7 in 3D Show helices and sheets RCSB PDB PDBe
5GL7 contains 38 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 230-241 | 12 | |
| α-helix | 243-246 | 4 | |
| α-helix | 250-253 | 4 | |
| β-strand | 265-270 | 6 | 1 |
| β-strand | 274 | 1 | 2 |
| β-strand | 280 | 1 | 3 |
| α-helix | 281-286 | 6 | |
| α-helix | 288-300 | 13 | |
| β-strand | 304-311 | 8 | 1 |
| β-strand | 312 | 1 | 2 |
| α-helix | 316-324 | 9 | |
| α-helix | 329-346 | 18 | |
| β-strand | 353-356 | 4 | 1 |
| α-helix | 360-374 | 15 | |
| β-strand | 379-389 | 11 | 4 |
| β-strand | 394-395 | 2 | 4 |
| α-helix | 396-397 | 2 | |
| α-helix | 398-400 | 3 | |
| β-strand | 401-404 | 4 | 5 |
| β-strand | 413-414 | 2 | 5 |
| β-strand | 417 | 1 | 6 |
| β-strand | 424 | 1 | 6 |
| α-helix | 427-429 | 3 | |
| β-strand | 431-435 | 5 | 5 |
| β-strand | 443-452 | 10 | 4 |
| α-helix | 454-468 | 15 | |
| α-helix | 476-488 | 13 | |
| β-strand | 493-494 | 2 | 4 |
| β-strand | 496-497 | 2 | 7 |
| α-helix | 503 | 1 | |
| β-strand | 504 | 1 | 7 |
| α-helix | 505 | 1 | |
| β-strand | 514-515 | 2 | 7 |
| α-helix | 517-520 | 4 | |
| α-helix | 524-532 | 9 | |
| α-helix | 537-540 | 4 | |
| β-strand | 546-553 | 8 | 1 |
| α-helix | 554-556 | 3 | |
| α-helix | 557-558 | 2 | |
| α-helix | 559-563 | 5 | |
| α-helix | 564-571 | 8 | |
| β-strand | 578-584 | 7 | 1 |
| β-strand | 587-589 | 3 | 8 |
| β-strand | 592 | 1 | 8 |
| β-strand | 595 | 1 | 9 |
| β-strand | 600 | 1 | 9 |
| β-strand | 603 | 1 | 3 |
| α-helix | 607-610 | 4 | |
| α-helix | 614-623 | 10 | |
| β-strand | 631-633 | 3 | 8 |
| α-helix | 635-641 | 7 | |
| α-helix | 642-650 | 9 | |
| α-helix | 651-664 | 14 | |
| β-strand | 668 | 1 | 10 |
| α-helix | 669-671 | 3 | |
| α-helix | 676-696 | 21 | |
| α-helix | 701-722 | 22 | |
| α-helix | 724-727 | 4 | |
| α-helix | 732-755 | 24 | |
| α-helix | 761-771 | 11 | |
| α-helix | 775-778 | 4 | |
| α-helix | 793 | 1 | |
| β-strand | 794 | 1 | 10 |
| α-helix | 795 | 1 | |
| α-helix | 804-806 | 3 | |
| α-helix | 807-816 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Methionine--tRNA ligase, cytoplasmic | A | protein | 624 | Homo sapiens | P56192 (AlphaFold model) |
>5GL7_1 Methionine--tRNA ligase, cytoplasmic (chains A) MSEEEELATLSEEEIAMAVTAWEKGLESLPPLRPQQNPVLPVAGERNVLITSALPYVNNV PHLGNIIGCVLSADVFARYSRLRQWNTLYLCGTDEYGTATETKALEEGLTPQEICDKYHI IHADIYRWFNISFDIFGRTTTPQQTKITQDIFQQLLKRGFVLQDTVEQLRCEHCARFLAD RFVEGVCPFCGYEEARGDQCDKCGKLINAVELKKPQCKVCRSCPVVQSSQHLFLDLPKLE KRLEEWLGRTLPGSDWTPNAQFITRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVW FDATIGYLSITANYTDQWERWWKNPEQVDLYQFMAKDNVPFHSLVFPCSALGAEDNYTLV SHLIATEYLNYEDGKFSKSRGVGVFGDMAQDTGIPADIWRFYLLYIRPEGQDSAFSWTDL LLKNNSELLNNLGNFINRAGMFVSKFFGGYVPEMVLTPDDQRLLAHVTLELQHYHQLLEK VRIRDALRSILTISRHGNQYIQVNEPWKRIKGSEADRQRAGTVTGLAVNIAALLSVMLQP YMPTVSATIQAQLQLPPPACSILLTNFLCTLPAGHQIGTVSPLFQKLENDQIESLRQRFG GGQAKTSPKPAVVETVLEHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Water and common crystallization additives (GOL) are not listed.
Crystal structure of a truncated human cytosolic methionyl-tRNA synthetase. Cho, H.Y., Lee, H.J., Kang, B.S. To be published.
Other PDB entries of the same protein (UniProt P56192 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5GL7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.