5GLH: Human endothelin receptor type-B

Human endothelin receptor type-B in complex with ET-1. Determined by X-ray diffraction at 2.8 Å resolution. Released 7 Sept 2016.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,643
Mol. weight: 58.45 kDa
Released: 7 Sept 2016

Explore 5GLH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5GLH contains 22 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	98-128	31
α-helix	136-154	19
α-helix	156-163	8
α-helix	171-204	34
α-helix	219-239	21
β-strand	240-247	8	1
β-strand	250-257	8	1
α-helix	264-278	15
α-helix	279-283	5
α-helix	284-1011	30
β-strand	1014-1015	2	2
β-strand	1016	1	3
β-strand	1017-1019	3	2
β-strand	1025-1028	4	2
β-strand	1031-1032	2	2
α-helix	1039-1050	12
β-strand	1057	1	3
α-helix	1060-1080	21
α-helix	1085-1090	6
α-helix	1093-1111	19
α-helix	1115-1122	8
α-helix	1126-1133	8
α-helix	1137-1141	5
α-helix	1143-1155	13
α-helix	313-325	13
α-helix	327-335	9
α-helix	337-349	13
α-helix	357-390	34
α-helix	392-398	7

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	9-17	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endothelin Receptor Subtype-B	A	protein	498	Homo sapiens	P00720, P24530 (AlphaFold model)
Peptide from Endothelin-1	B	protein	21	Homo sapiens	P05305 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5GLH_1 Endothelin Receptor Subtype-B (chains A)
GGGLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTL
LYIIYKNKCMRNGPNILIASLALGDLLHIVIAIPINVYKLLAEDWPFGAEMCKLVPFIQK
ASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDI
ITMDYKGSYLRICLLHPVQKTAFMQFYATAKDWWLFSFYFCLPLAITAFFYTLMTCEMLR
KNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITK
DEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRM
LQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLNDHLKQRREVAKTVFCLV
LVFALCWLPLHLARILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCANPIALYLV
SKRFKNAFKSALCCWAQS

Sequence of entity 2 (B), FASTA

>5GLH_2 Peptide from Endothelin-1 (chains B)
CSCSSLMDKECVYFCHLDIIW

Primary citation

Activation mechanism of endothelin ETB receptor by endothelin-1. Shihoya, W., Nishizawa, T., Okuta, A. et al. Nature (2016) 537:363-368. DOI 10.1038/nature19319 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…

Browse structure collections

About this viewer

MolViewer shows 5GLH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.