5GLI: Endothelin Receptor Subtype-B

Human endothelin receptor type-B in the ligand-free form. Determined by X-ray diffraction at 2.5 Å resolution. Released 7 Sept 2016.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,451
Mol. weight: 53.56 kDa
Ligands: OLC, OLA
Released: 7 Sept 2016

Explore 5GLI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5GLI contains 21 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	92-128	37
α-helix	130-133	4
α-helix	138-164	27
α-helix	171-203	33
α-helix	216-231	16
α-helix	234-239	6
β-strand	240-247	8	1
β-strand	250-257	8	1
α-helix	264-271	8
α-helix	273-278	6
α-helix	279-283	5
α-helix	284-1010	29
α-helix	1018-1037	20
α-helix	1042-1047	6
α-helix	1050-1068	19
α-helix	1072-1079	8
α-helix	1083-1091	9
α-helix	1094-1098	5
α-helix	1100-1112	13
α-helix	1116-1118	3
α-helix	313-349	37
α-helix	357-389	33
α-helix	391-402	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endothelin Receptor Subtype-B	A	protein	464	Homo sapiens	P00720, P24530 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5GLI_1 Endothelin Receptor Subtype-B (chains A)
GGGLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTL
LYIIYKNKCMRNGPNILIASLALGDLLHIVIAIPINVYKLLAEDWPFGAEMCKLVPFIQK
ASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDI
ITMDYKGSYLRICLLHPVQKTAFMQFYATAKDWWLFSFYFCLPLAITAFFYTLMTCEMLR
KNIFEMLRIDEGGGSGGDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMV
FQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLN
DHLKQRREVAKTVFCLVLVFALCWLPLHLARILKLTLYNQNDPNRCELLSFLLVLDYIGI
NMASLNSCANPIALYLVSKRFKNAFKSALCCWAQSPSSENLYFQ

Ligands and cofactors

ID	Name	Formula	Copies
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	2
OLA	Oleic acid	C18 H34 O2	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Activation mechanism of endothelin ETB receptor by endothelin-1. Shihoya, W., Nishizawa, T., Okuta, A. et al. Nature (2016) 537:363-368. DOI 10.1038/nature19319 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…

Browse structure collections

About this viewer

MolViewer shows 5GLI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.