5H0U: Matrix metalloproteinase-14

Crystal structure of the catalytic domain of membrane type 1 matrix metalloproteinase. Determined by X-ray diffraction at 2.24 Å resolution. Released 4 Oct 2017.

Method: X-ray diffraction
Resolution: 2.24 Å
Organisms: Homo sapiens, unidentified
Chains: 2
Atoms: 1,567
Mol. weight: 21.44 kDa
Ligands: CA, ZN
Released: 4 Oct 2017

Explore 5H0U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5H0U contains 6 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	123-128	6	1
α-helix	137-152	16
β-strand	158-161	4	1
α-helix	164-168	5
β-strand	177-182	6	1
β-strand	200-202	3	1
α-helix	203-204	2
β-strand	213-216	4	1
β-strand	221-222	2	2
β-strand	231-232	2	2
α-helix	233-244	12
α-helix	247-250	4
α-helix	273-283	11

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	32	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Matrix metalloproteinase-14	A	protein	170	Homo sapiens	P50281 (AlphaFold model)
His-his-his-his-his-his	B	protein	6	unidentified

Sequence of entity 1 (A), FASTA

>5H0U_1 Matrix metalloproteinase-14 (chains A)
GLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQA
DIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFL
VAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGG

Sequence of entity 2 (B), FASTA

>5H0U_2 HIS-HIS-HIS-HIS-HIS-HIS (chains B)
HHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2
ZN	Zinc ion	Zn	3

Water and common crystallization additives (EPE, GOL) are not listed.

Primary citation

Solvent water interactions within the active site of the membrane type I matrix metalloproteinase. Decaneto, E., Vasilevskaya, T., Kutin, Y. et al. Phys Chem Chem Phys (2017) 19:30316-30331. DOI 10.1039/c7cp05572b · PubMed

Other PDB entries of the same protein (UniProt P50281 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3C7X 1.7 Å, Hemopexin-like domain of matrix metalloproteinase 14
4P3C 1.94 Å, MT1-MMP:Fab complex (Form I)
4P3D 1.95 Å, MT1-MMP:Fab complex (Form II)
3MA2 2.05 Å, Complex membrane type-1 matrix metalloproteinase (MT1-MMP) with tissue inhibitor of…
4QXU 2.3 Å, Novel Inhibition Mechanism of Membrane Metalloprotease by an Exosite-Swiveling…
3X23 2.4 Å, Radixin complex
1BQQ 2.75 Å, Crystal structure of the MT1-mmp--timp-2 complex
1BUV 2.75 Å, Crystal structure of the MT1-mmp-timp-2 complex
2MQS Transient Collagen Triple Helix Binding to a Key Metalloproteinase in Invasion and…
6CLZ MT1-MMP HPX domain with Blade 4 Loop Bound to Nanodiscs
6CM1 MT1-MMP HPX Domain with Blade 2 Loop Bound to Nanodiscs

Browse structure collections

About this viewer

MolViewer shows 5H0U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.