5H77: PKA-protein A fusion protein

Crystal structure of the PKA-protein A fusion protein. Determined by X-ray diffraction at 3.2 Å resolution. Released 28 Jun 2017.

Method: X-ray diffraction
Resolution: 3.2 Å
Organisms: Homo sapiens, Staphylococcus aureus
Chains: 12
Atoms: 8,143
Mol. weight: 123.77 kDa
Released: 28 Jun 2017

Explore 5H77 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5H77 contains 52 α-helices and 0 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	7-21	15
α-helix	26-47	22
α-helix	54-65	12
α-helix	71-82	12

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	3-4	2
α-helix	7-21	15
α-helix	26-48	23
α-helix	54-66	13
α-helix	71-85	15

Chain C: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	7-21	15
α-helix	26-47	22
α-helix	54-66	13
α-helix	71-83	13

Chain D: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	3-4	2
α-helix	7-21	15
α-helix	26-46	21
α-helix	54-66	13
α-helix	71-82	12

Chain E: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	3-4	2
α-helix	7-21	15
α-helix	26-48	23
α-helix	54-66	13
α-helix	71-80	10

Chain F: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	7-21	15
α-helix	26-47	22
α-helix	54-66	13
α-helix	71-84	14

Chains G and I: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	7-21	15
α-helix	26-47	22
α-helix	54-66	13
α-helix	73-80	8

Chain H: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	3-4	2
α-helix	7-21	15
α-helix	26-46	21
α-helix	54-66	13
α-helix	71-81	11

3 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cAMP-dependent protein kinase type II-alpha regulatory subunit,Immunoglobulin G-binding protein A	A, B, C, D, E, F, G, H, I, J, K, L	protein	90	Homo sapiens, Staphylococcus aureus	P13861 (AlphaFold model), P38507 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L), FASTA

>5H77_1 cAMP-dependent protein kinase type II-alpha regulatory subunit,Immunoglobulin G-binding protein A (chains A, B, C, D, E, F, G, H, I, J, K, L)
GSPWQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLRQQRAFYEILHLPNLNEEQR
NAFIQSLKDDPSQSANLLAEAKKLNDAQAP

Primary citation

Construction of novel repeat proteins with rigid and predictable structures using a shared helix method. Youn, S.J., Kwon, N.Y., Lee, J.H. et al. Sci Rep (2017) 7:2595-2595. DOI 10.1038/s41598-017-02803-z · PubMed

Other PDB entries of the same protein (UniProt P13861 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2IZX 1.3 Å, Molecular Basis of AKAP Specificity for PKA Regulatory Subunits
5H78 2.0 Å, Crystal structure of the PKA-DHR14 fusion protein
9NXN 2.1 Å, Crystal structure of CN:RII alpha
4ZP3 2.63 Å, AKAP18:PKA-RIIalpha structure reveals crucial anchor points for recognition of…
5XBY 3.25 Å, Crystal structure of the PKA-Protein A fusion protein (end-to-end fusion)
2KYG Structure of the AML1-ETO Nervy Domain - PKA(RIIa) complex and its contribution to…
8S8O Solution Structure of cAMP-dependent Protein Kinase RII-alpha Subunit Dimerization and…

Browse structure collections

About this viewer

MolViewer shows 5H77 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.