5HDA: BS69 coiled coil-MYND domains

Crystal Structure of the BS69 coiled coil-MYND domains bound to an EBNA2 PXLXP motif. Determined by X-ray diffraction at 2.39 Å resolution. Released 20 Jan 2016.

Method: X-ray diffraction
Resolution: 2.39 Å
Organisms: Homo sapiens, Human herpesvirus 4
Chains: 4
Atoms: 2,186
Mol. weight: 32.58 kDa
Ligands: ZN
Released: 20 Jan 2016

Explore 5HDA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5HDA contains 10 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	442-518	77
β-strand	522	1	1
β-strand	523	1	2
β-strand	529	1	1
α-helix	530	1
β-strand	532-535	4	2
β-strand	538-540	3	2
α-helix	543-552	10
α-helix	554-556	3

Chains B and D: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	382-385	4
β-strand	387	1	2

Chain C: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	446-518	73
β-strand	522	1	3
β-strand	523	1	4
β-strand	529	1	3
α-helix	530	1
β-strand	532-535	4	4
β-strand	538-540	3	4
α-helix	543-552	10
α-helix	554-556	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Zinc finger MYND domain-containing protein 11	A, C	protein	124	Homo sapiens	Q15326 (AlphaFold model)
Epstein-Barr nuclear antigen 2	B, D	protein	9	Human herpesvirus 4	P12978 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>5HDA_1 Zinc finger MYND domain-containing protein 11 (chains A, C)
SDRMKSDHKRETERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEE
FVEEIKKLATQHKQLISQTKKKQWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTC
RRKR

Sequence of entity 2 (B, D), FASTA

>5HDA_2 Epstein-Barr nuclear antigen 2 (chains B, D)
SMPELSPVL

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

BS69/ZMYND11 C-Terminal Domains Bind and Inhibit EBNA2. Harter, M.R., Liu, C.D., Shen, C.L. et al. PLoS Pathog (2016) 12:e1005414-e1005414. DOI 10.1371/journal.ppat.1005414 · PubMed

Other PDB entries of the same protein (UniProt Q15326 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8XU6 1.63 Å, Structural Insights into the Tumor Suppressor ZMYND11 Reveal Diverse Recognition…
9LOM 1.63 Å, Study on the structure and function of tumor suppressor ZMYND11
9LOA 1.8 Å, Structural insights into the tumor suppressor ZMYND11 reveal diverse recognition…
9M0U 1.89 Å, Structural insights into the tumor suppressor ZMYND11 reveal diverse recognition…
4NS5 1.9 Å, Crystal structure of human BS69 Bromo-Zinc finger-PWWP
9LP4 2.96 Å, Structural insights into the Tumor suppressor ZMYND11 reveal diverse recognition…
9VC7 3.35 Å, Structural insights into the tumor suppressor ZMYND11 reveal diverse recognition…

Browse structure collections

About this viewer

MolViewer shows 5HDA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.