Human Beclin 1 coiled-coil domain. Determined by X-ray diffraction at 1.46 Å resolution. Released 20 Jul 2016.
Explore 5HHE in 3D Show helices and sheets RCSB PDB PDBe
5HHE contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 176-266 | 91 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Beclin-1 | A, D | protein | 93 | Homo sapiens | Q14457 (AlphaFold model) |
>5HHE_1 Beclin-1 (chains A, D) DDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYS EFKRQQLELDDELKSVENQMRYAQTQLDKLKLE
Identification of BECN1 and ATG14 Coiled-Coil Interface Residues That Are Important for Starvation-Induced Autophagy. Mei, Y., Su, M., Sanishvili, R. et al. Biochemistry (2016) 55:4239-4253. DOI 10.1021/acs.biochem.6b00246 · PubMed
Other PDB entries of the same protein (UniProt Q14457 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5HHE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.