5HOB: P73 homo-tetramerization domain mutant I

p73 homo-tetramerization domain mutant I. Determined by X-ray diffraction at 1.22 Å resolution. Released 19 Oct 2016.

Method: X-ray diffraction
Resolution: 1.22 Å
Organism: Homo sapiens
Chains: 8
Atoms: 3,296
Mol. weight: 48.3 kDa
Ligands: MG
Released: 19 Oct 2016

Explore 5HOB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5HOB contains 20 α-helices and 8 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, D and E: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	354-360	7	1
α-helix	362-377	16
α-helix	378-380	3
α-helix	383-394	12

Chains B and C: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	354-360	7	1
α-helix	362-378	17
α-helix	383-393	11

Chains F and G: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	354-360	7	3
α-helix	362-378	17
α-helix	383-395	13

Chain H: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	354-360	7	4
α-helix	362-377	16
α-helix	378-380	3
α-helix	383-393	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor protein p73	A, B, C, D, E, F, G, H	protein	50	Homo sapiens	O15350 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>5HOB_1 Tumor protein p73 (chains A, B, C, D, E, F, G, H)
GSDEDTYYLQVRGRKNFEILMELKRSLELMELVPQPLVDSYEQQQQLLQR

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Primary citation

Structural basis of p63/p73 hetero-tetramerization. Gebel, J., Luh, L., Coutandin, D. et al. To be published.

Other PDB entries of the same protein (UniProt O15350 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5HOC 1.36 Å, p73 homo-tetramerization domain mutant II
2WQI 1.7 Å, Crystal structure of the human p73 tetramerization domain
8P9C 1.76 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…
9GNB 1.8 Å, Structure of p73 SAM domain in complex with DARPin B9
2XWC 1.82 Å, Crystal structure of the DNA binding domain of human TP73 refined at 1.8 A resolution
2WQJ 2.0 Å, Crystal structure of a truncated variant of the human p73 tetramerization domain
9GLQ 2.1 Å, Crystal structure of p73 tetramerisation domain in complex with darpins 1800
8P9E 2.25 Å, Crystal structure of wild type p63-p73 heterotetramer (tetramerisation domain) in…
4A63 2.27 Å, Crystal structure of the p73-ASPP2 complex at 2.6A resolution
2WTT 2.3 Å, Structure of the human p73 tetramerization domain (crystal form II)
1DXS 2.54 Å, Crystal structure of the C-terminal sterile alpha motif (SAM) domain of human p73 alpha…
8P9D 2.7 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…

Browse structure collections

About this viewer

MolViewer shows 5HOB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.