5ITA: BRAF Kinase Domain

Crystal Structure of BRAF Kinase Domain Bound to AZ-VEM. Determined by X-ray diffraction at 1.95 Å resolution. Released 10 Aug 2016.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,177
Mol. weight: 68.26 kDa
Ligands: 6DC
Released: 10 Aug 2016

Explore 5ITA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5ITA contains 31 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	451	1	1
α-helix	452-453	2
β-strand	458-466	9	1
β-strand	469-475	7	1
β-strand	479-485	7	1
α-helix	492-506	15
β-strand	513	1	2
β-strand	516-520	5	1
β-strand	526-530	5	1
β-strand	536	1	2
α-helix	537-539	3
α-helix	540-544	5
α-helix	550-569	20
α-helix	579-581	3
β-strand	582-585	4	2
β-strand	589-592	4	2
α-helix	617-619	3
α-helix	622-625	4
α-helix	635-651	17
α-helix	662-671	10
α-helix	678-680	3
α-helix	687-696	10
α-helix	701-703	3
α-helix	705-706	2
α-helix	707-717	11

Chain B: 16 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	451	1	3
α-helix	452-453	2
β-strand	458-464	7	3
β-strand	470-475	6	3
β-strand	479-484	6	3
α-helix	492-505	14
β-strand	513	1	4
β-strand	516-520	5	3
β-strand	526-530	5	3
α-helix	531-532	2
β-strand	536	1	4
α-helix	537-542	6
α-helix	546-549	4
α-helix	550-569	20
α-helix	579-581	3
β-strand	582-585	4	4
β-strand	589-592	4	4
α-helix	617-619	3
α-helix	622-625	4
α-helix	635-651	17
α-helix	662-670	9
α-helix	678-680	3
α-helix	687-696	10
α-helix	701-703	3
α-helix	705-706	2
α-helix	707-717	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase B-raf	A, B	protein	297	Homo sapiens	P15056 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5ITA_1 Serine/threonine-protein kinase B-raf (chains A, B)
MGSSHHHHHHSSGLVPRGSHMDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLN
VTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHASET
KFEMKKLIDIARQTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFGLATVKSRWSG
SHQFEQLSGSILWMAPEVIRMQDSNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQII
EMVGRGSLSPDLSKVRSNCPKRMKRLMAECLKKKRDERPSFPRILAEIEELARELSG

Ligands and cofactors

ID	Name	Formula	Copies
6DC	N-{2-cyano-3-[(3-methyl-4-oxo-3,4-dihydroquinazolin-6-yl)amino]phenyl}propane-1…	C19 H19 N5 O3 S	2

Primary citation

An integrated model of RAF inhibitor action predicts inhibitor activity against oncogenic BRAF signaling. Karoulia, Z., Wu, Y., Ahmed, T.A. et al. Cancer Cell (2016) 30:1-14.

Other PDB entries of the same protein (UniProt P15056 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8VSO 1.5 Å, Ternary structure of 14-3-3 sigma, BRAF phosphopeptide (pS365) and compound 78 (1124378)
8JNB 1.62 Å, CRAF ras-binding domain chimera, ligand complex
8C7X 1.65 Å, Crystal structure of BRAF in complex with a hybrid compound 6
8C7Y 1.65 Å, Crystal structure of BRAF V600E in complex with a hybrid compound 6
9EW6 1.65 Å, Binary structure of 14-3-3s and BRAF phosphopeptide (pS365)
8JNA 1.7 Å, CRAF ras-binding domain chimera, apo form
9BP8 1.73 Å, Crystal structure of BRAF kinase domain with PF-07799933
5VYK 1.75 Å, Crystal structure of the BRS domain of BRAF in complex with the CC-SAM domain of KSR1
9BFB 1.92 Å, Crystal structure of BRAF kinase domain with PF-07284890
7K0V 1.93 Å, Crystal structure of bRaf in complex with inhibitor GNE-0749
3NY5 1.99 Å, Crystal structure of the RBD domain of serine/threonine-protein kinase B-raf from Homo…
4XV9 2.0 Å, B-Raf Kinase domain in complex with PLX5568

Browse structure collections

About this viewer

MolViewer shows 5ITA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.