Crystal structure of human Karyopherin-beta2 bound to the histone H3 tail. Determined by X-ray diffraction at 3.05 Å resolution. Released 21 Sept 2016.
Explore 5J3V in 3D Show helices and sheets RCSB PDB PDBe
5J3V contains 130 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 13-21 | 9 | |
| α-helix | 27-39 | 13 | |
| α-helix | 47-55 | 9 | |
| α-helix | 62-74 | 13 | |
| α-helix | 85-97 | 13 | |
| α-helix | 104-117 | 14 | |
| α-helix | 130-133 | 4 | |
| α-helix | 142-158 | 17 | |
| α-helix | 171-173 | 3 | |
| α-helix | 175-181 | 7 | |
| α-helix | 182-184 | 3 | |
| α-helix | 188-199 | 12 | |
| α-helix | 207-210 | 4 | |
| α-helix | 213-222 | 10 | |
| α-helix | 223-225 | 3 | |
| α-helix | 229-245 | 17 | |
| α-helix | 247-249 | 3 | |
| α-helix | 254-264 | 11 | |
| α-helix | 270-283 | 14 | |
| α-helix | 289-306 | 18 | |
| α-helix | 310-311 | 2 | |
| α-helix | 314-317 | 4 | |
| α-helix | 375-390 | 16 | |
| α-helix | 391-394 | 4 | |
| α-helix | 395-406 | 12 | |
| α-helix | 411-423 | 13 | |
| α-helix | 429-432 | 4 | |
| α-helix | 433-435 | 3 | |
| α-helix | 436-446 | 11 | |
| α-helix | 452-463 | 12 | |
| α-helix | 466-471 | 6 | |
| α-helix | 478-489 | 12 | |
| α-helix | 494-511 | 18 | |
| α-helix | 512-515 | 4 | |
| α-helix | 519-528 | 10 | |
| α-helix | 538-552 | 15 | |
| α-helix | 553-556 | 4 | |
| α-helix | 559-575 | 17 | |
| α-helix | 583-597 | 15 | |
| α-helix | 598-604 | 7 | |
| α-helix | 605-628 | 24 | |
| α-helix | 634-636 | 3 | |
| α-helix | 638-655 | 18 | |
| α-helix | 656-659 | 4 | |
| α-helix | 660-663 | 4 | |
| α-helix | 668-675 | 8 | |
| α-helix | 681-697 | 17 | |
| α-helix | 699-702 | 4 | |
| α-helix | 703-705 | 3 | |
| α-helix | 706-715 | 10 | |
| α-helix | 722-739 | 18 | |
| α-helix | 740-746 | 7 | |
| α-helix | 748-759 | 12 | |
| α-helix | 765-781 | 17 | |
| α-helix | 783-785 | 3 | |
| α-helix | 787-789 | 3 | |
| α-helix | 790-801 | 12 | |
| α-helix | 808-817 | 10 | |
| α-helix | 819-822 | 4 | |
| α-helix | 826-829 | 4 | |
| α-helix | 832-839 | 8 | |
| α-helix | 847-864 | 18 | |
| α-helix | 866-873 | 8 | |
| α-helix | 878-887 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 34-37 | 4 | |
| α-helix | 40-42 | 3 | |
| α-helix | 52-56 | 5 | |
| α-helix | 62-75 | 14 | |
| α-helix | 89-96 | 8 | |
| α-helix | 104-109 | 6 | |
| α-helix | 130-133 | 4 | |
| α-helix | 142-156 | 15 | |
| α-helix | 180-182 | 3 | |
| α-helix | 188-198 | 11 | |
| α-helix | 199-201 | 3 | |
| α-helix | 207-210 | 4 | |
| α-helix | 214-217 | 4 | |
| α-helix | 229-244 | 16 | |
| α-helix | 247-249 | 3 | |
| α-helix | 255-264 | 10 | |
| α-helix | 270-282 | 13 | |
| α-helix | 300-307 | 8 | |
| α-helix | 310-311 | 2 | |
| α-helix | 312-317 | 6 | |
| α-helix | 375-387 | 13 | |
| α-helix | 391-393 | 3 | |
| α-helix | 395-397 | 3 | |
| α-helix | 399-406 | 8 | |
| α-helix | 411-423 | 13 | |
| α-helix | 429-432 | 4 | |
| α-helix | 436-445 | 10 | |
| α-helix | 446-448 | 3 | |
| α-helix | 452-464 | 13 | |
| α-helix | 466-469 | 4 | |
| α-helix | 474-478 | 5 | |
| α-helix | 479-489 | 11 | |
| α-helix | 494-511 | 18 | |
| α-helix | 512-518 | 7 | |
| α-helix | 519-532 | 14 | |
| α-helix | 538-552 | 15 | |
| α-helix | 553-556 | 4 | |
| α-helix | 559-574 | 16 | |
| α-helix | 583-597 | 15 | |
| α-helix | 598-604 | 7 | |
| α-helix | 605-628 | 24 | |
| α-helix | 634-636 | 3 | |
| α-helix | 639-655 | 17 | |
| α-helix | 656-659 | 4 | |
| α-helix | 660-665 | 6 | |
| α-helix | 668-675 | 8 | |
| α-helix | 681-697 | 17 | |
| α-helix | 699-702 | 4 | |
| α-helix | 703-705 | 3 | |
| α-helix | 706-715 | 10 | |
| α-helix | 722-739 | 18 | |
| α-helix | 740-746 | 7 | |
| α-helix | 748-758 | 11 | |
| α-helix | 765-781 | 17 | |
| α-helix | 783-786 | 4 | |
| α-helix | 787-789 | 3 | |
| α-helix | 790-800 | 11 | |
| α-helix | 808-821 | 14 | |
| α-helix | 829-831 | 3 | |
| α-helix | 832-839 | 8 | |
| α-helix | 847-872 | 26 | |
| α-helix | 873-875 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 14-19 | 6 | |
| α-helix | 21-26 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 15-19 | 5 | |
| α-helix | 21-25 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transportin-1,Transportin-1 | A, B | protein | 854 | Homo sapiens | Q92973 (AlphaFold model) |
| Histone H3 | C, D | protein | 17 | Homo sapiens | P68431 (AlphaFold model) |
>5J3V_1 Transportin-1,Transportin-1 (chains A, B) MEYEWKPDEQGLQQILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSE DEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASK GELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEILDSDVLDRPLNIMIPKFL QFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFIENLFALAGDEEPEVRKNVCRALV MLLEVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRHLPKL IPVLVNGMKYSDIDIILLKGDVEGGSGGSGDDTISDWNLRKCSAAALDVLANVYRDELLP HILPLLKELLFHHEWVVKESGILVLGAIAEGCMQGMIPYLPELIPHLIQCLSDKKALVRS ITCWTLSRYAHWVVSQPPDTYLKPLMTELLKRILDSNKRVQEAACSAFATLEEEACTELV PYLAYILDTLVFAFSKYQHKNLLILYDAIGTLADSVGHHLNKPEYIQMLMPPLIQKWNML KDEDKDLFPLLECLSSVATALQSGFLPYCEPVYQRCVNLVQKTLAQAMLNNAQPDQYEAP DKDFMIVALDLLSGLAEGLGGNIEQLVARSNILTLMYQCMQDKMPEVRQSSFALLGDLTK ACFQHVKPCIADFMPILGTNLNPEFISVCNNATWAIGEISIQMGIEMQPYIPMVLHQLVE IINRPNTPKTLLENTAITIGRLGYVCPQEVAPMLQQFIRPWCTSLRNIRDNEEKDSAFRG ICTMISVNPSGVIQDFIFFCDAVASWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQF PLPLKERLAAFYGV
>5J3V_2 Histone H3 (chains C, D) TGGKAPRKQLATKAARK
Karyopherin-beta 2 Recognition of a PY-NLS Variant that Lacks the Proline-Tyrosine Motif. Soniat, M., Chook, Y.M. Structure (2016) 24:1802-1809. DOI 10.1016/j.str.2016.07.018 · PubMed
Other PDB entries of the same protein (UniProt Q92973 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5J3V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.