5JHG: Rho guanine nucleotide exchange factor 11

Crystal structure of the complex between the human RhoA and the DH/PH domain of human ARHGEF11. Determined by X-ray diffraction at 2.5 Å resolution. Released 26 Apr 2017.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 4
Atoms: 8,796
Mol. weight: 127.12 kDa
Released: 26 Apr 2017

Explore 5JHG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JHG contains 55 α-helices and 34 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	730-755	26
α-helix	756-761	6
α-helix	762-766	5
α-helix	772-778	7
α-helix	782-801	20
α-helix	810-817	8
α-helix	820-833	14
α-helix	836-849	14
α-helix	851-861	11
α-helix	864-866	3
α-helix	871-875	5
α-helix	877-894	18
α-helix	901-938	38
β-strand	940-941	2	1
α-helix	951-954	4
α-helix	955-958	4
α-helix	961-963	3
β-strand	966-974	9	2
β-strand	983-989	7	2
β-strand	992-994	3	2
β-strand	997-999	3	1
β-strand	1002-1004	3	1
β-strand	1025-1027	3	2
α-helix	1028-1030	3
β-strand	1031-1034	4	2
β-strand	1042-1047	6	2
β-strand	1055	1	3
β-strand	1057-1060	4	2
α-helix	1064-1080	17

Chain B: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	5-12	8	4
α-helix	18-27	10
β-strand	42-48	7	4
β-strand	51-58	8	4
α-helix	70-73	4
β-strand	79-85	7	4
α-helix	89-94	6
α-helix	95-99	5
α-helix	100-106	7
β-strand	112-117	6	4
α-helix	119-121	3
α-helix	125-133	9
α-helix	138-140	3
α-helix	141-151	11
β-strand	155-158	4	4
α-helix	167-179	13

Chain E: 18 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	725-727	3
α-helix	730-755	26
α-helix	756-761	6
α-helix	762-766	5
α-helix	772-778	7
α-helix	782-801	20
α-helix	810-817	8
α-helix	820-833	14
α-helix	836-849	14
α-helix	851-861	11
α-helix	864-866	3
α-helix	871-874	4
α-helix	877-894	18
α-helix	901-938	38
β-strand	940-941	2	3
α-helix	952-957	6
α-helix	961-963	3
β-strand	966-977	12	3
β-strand	980-989	10	3
β-strand	992-998	7	3
β-strand	1003-1004	2	3
β-strand	1008	1	5
β-strand	1022	1	5
β-strand	1025-1027	3	3
α-helix	1028-1030	3
β-strand	1031-1035	5	3
β-strand	1043-1047	5	3
β-strand	1055-1060	6	3
α-helix	1064-1079	16

Chain F: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	4-12	9	6
α-helix	18-27	10
β-strand	42-48	7	6
β-strand	51-58	8	6
α-helix	70-73	4
β-strand	79-85	7	6
α-helix	89-94	6
α-helix	95-99	5
α-helix	100-106	7
β-strand	112-117	6	6
α-helix	119-121	3
α-helix	125-133	9
α-helix	141-151	11
β-strand	155-158	4	6
α-helix	167-179	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rho guanine nucleotide exchange factor 11	A, E	protein	369	Homo sapiens	O15085 (AlphaFold model)
Transforming protein RhoA	B, F	protein	181	Homo sapiens	P61586 (AlphaFold model)

Sequence of entity 1 (A, E), FASTA

>5JHG_1 Rho guanine nucleotide exchange factor 11 (chains A, E)
MQNWQHTVGKDVVAGLTQREIDRQEVINELFVTEASHLRTLRVLDLIFYQRMKKENLMPR
EELARLFPNLPELIEIHNSWCEAMKKLREEGPIIKEISDLMLARFDGPAREELQQVAAQF
CSYQSIALELIKTKQRKESRFQLFMQEAESHPQCRRLQLRDLIISEMQRLTKYPLLLESI
IKHTEGGTSEHEKLCRARDQCREILKYVNEAVKQTENRHRLEGYQKRLDATALERASNPL
AAEFKSLDLTTRKMIHEGPLTWRISKDKTLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTA
VGSSDSKQTFSPVLKLNAVLIRSVATDKRAFFIICTSKLGPPQIYELVALTSSDKNTWME
LLEEAVRNA

Sequence of entity 2 (B, F), FASTA

>5JHG_2 Transforming protein RhoA (chains B, F)
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
A

Primary citation

Crystallization and preliminary X-ray crystallographic analysis of a small GTPase RhoA bound with its inhibitor and ARHGEF11. Wang, R., Yan, Z., Lv, Z. et al. To be published.

Other PDB entries of the same protein (UniProt O15085 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1HTJ 2.2 Å, Structure of the rgs-like domain from PDZ-rhogef
5JHH 2.3 Å, Crystal structure of the ternary complex between the human RhoA, its inhibitor and the…
5TYT 2.4 Å, Crystal Structure of the PDZ domain of RhoGEF bound to CXCR2 C-terminal peptide
1XCG 2.5 Å, Crystal Structure of Human RhoA in complex with DH/PH fragment of PDZRHOGEF
3KZ1 2.7 Å, Crystal Structure of the Complex of PDZ-RhoGEF DH/PH domains with GTP-gamma-S Activated…
3T06 2.84 Å, Crystal Structure of the DH/PH fragment of PDZRHOGEF with N-terminal regulatory elements…
5E6P 3.21 Å, PlexinB2 cytoplasmic region/PDZ-RhoGEF PDZ domain complex
2DLS Solution structure of the PDZ domain of human Rho guanine nucleotide exchange factor 11

Browse structure collections

About this viewer

MolViewer shows 5JHG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.