5JPZ: PDB entry 5JPZ

Crystal structure of HAT domain of human Squamous Cell Carcinoma Antigen Recognized By T Cells 3, SART3 (TIP110). Determined by X-ray diffraction at 3.04 Å resolution. Released 11 May 2016.

Method: X-ray diffraction
Resolution: 3.04 Å
Organism: Homo sapiens
Chains: 2
Atoms: 8,115
Mol. weight: 120.2 kDa
Released: 11 May 2016

Explore 5JPZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JPZ contains 65 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 32 helices, 0 β-strands

Element	Residues	Length
α-helix	93-107	15
α-helix	112-124	13
α-helix	128-141	14
α-helix	143-145	3
α-helix	146-157	12
α-helix	163-178	16
α-helix	183-193	11
α-helix	194-196	3
α-helix	203-217	15
α-helix	224-237	14
α-helix	245-255	11
α-helix	262-272	11
α-helix	279-304	26
α-helix	306	1
α-helix	310-323	14
α-helix	326-339	14
α-helix	344-352	9
α-helix	353-358	6
α-helix	361-374	14
α-helix	379-391	13
α-helix	396-408	13
α-helix	414-429	16
α-helix	440-455	16
α-helix	456-460	5
α-helix	461-464	4
α-helix	473-484	12
α-helix	490-500	11
α-helix	504-506	3
α-helix	508-521	14
α-helix	524-537	14
α-helix	542-556	15
α-helix	559-573	15

Chain B: 33 helices, 0 β-strands

Element	Residues	Length
α-helix	93-107	15
α-helix	112-124	13
α-helix	128-141	14
α-helix	143-145	3
α-helix	146-157	12
α-helix	163-176	14
α-helix	183-194	12
α-helix	203-217	15
α-helix	224-238	15
α-helix	240-242	3
α-helix	245-255	11
α-helix	262-270	9
α-helix	279-304	26
α-helix	310-323	14
α-helix	326-339	14
α-helix	344-352	9
α-helix	353-357	5
α-helix	361-374	14
α-helix	379-391	13
α-helix	396-408	13
α-helix	414-429	16
α-helix	440-455	16
α-helix	456-460	5
α-helix	461-464	4
α-helix	473-480	8
α-helix	481-485	5
α-helix	486	1
α-helix	489-501	13
α-helix	504-506	3
α-helix	508-521	14
α-helix	524-537	14
α-helix	542-556	15
α-helix	559-573	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Squamous cell carcinoma antigen recognized by T-cells 3	A, B	protein	509	Homo sapiens	Q15020 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5JPZ_1 Squamous cell carcinoma antigen recognized by T-cells 3 (chains A, B)
MSYYHHHHHHDYDIPTTENLYFQGAMGSGILEIERLEEQLSINVYDYNCHVDLIRLLRLE
GELTKVRMARQKMSEIFPLTEELWLEWLHDEISMAQDGLDREHVYDLFEKAVKDYICPNI
WLEYGQYSVGGIGQKGGLEKVRSVFERALSSVGLHMTKGLALWEAYREFESAIVEAARLE
KVHSLFRRQLAIPLYDMEATFAEYEEWSEDPIPESVIQNYNKALQQLEKYKPYEEALLQA
EAPRLAEYQAYIDFEMKIGDPARIQLIFERALVENCLVPDLWIRYSQYLDRQLKVKDLVL
SVHNRAIRNCPWTVALWSRYLLAMERHGVDHQVISVTFEKALNAGFIQATDYVEIWQAYL
DYLRRRVDFKQDSSKELEELRAAFTRALEYLKQEVEERFNESGDPSCVIMQNWARIEARL
CNNMQKARELWDSIMTRGNAKYANMWLEYYNLERAHGDTQHCRKALHRAVQCTSDYPEHV
CEVLLTMERTEGSLEDWDIAVQKTETRLA

Primary citation

unpublished. Grazette, A., Harper, S., Emsley, J. et al. To be published.

Other PDB entries of the same protein (UniProt Q15020 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CTT 1.7 Å, Crystal structure of human SART3/TIP110 NLS-mouse importin alpha complex
5JJX 2.0 Å, Crystal structure of the HAT domain of sart3
5CTQ 2.6 Å, Crystal structure of human SART3/TIP110 half-a TPR (HAT) domain
5JJW 3.01 Å, Crystal structure of the HAT domain of sart3 in complex with USP15 DUSP-UBL domain
5CTR 3.01 Å, Crystal structure of human SART3 HAT-C domain-human USP4 DUSP-UBL domain complex
2DO4 Solution structure of the RNA binding domain of squamous cell carcinoma antigen…
7XX8 Solution structure of RRM1 of Human SART3
7XX9 Solution structure of RRM2 of Human SART3

Browse structure collections

About this viewer

MolViewer shows 5JPZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.