5K6P: Myosin-binding protein C, cardiac-type

The NMR structure of the m domain tri-helix bundle and C2 of human cardiac Myosin Binding Protein C. Determined by solution NMR. Released 9 Nov 2016.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,086
Mol. weight: 15.5 kDa
Released: 9 Nov 2016

Explore 5K6P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5K6P contains 5 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	321-326	6
α-helix	330-332	3
α-helix	333-340	8
α-helix	345-355	11
β-strand	365-367	3	1
α-helix	368-370	3
β-strand	372-376	5	2
β-strand	379-387	9	1
β-strand	395-398	4	2
β-strand	401-402	2	2
β-strand	410-415	6	1
β-strand	418-426	9	1
β-strand	433-438	6	2
β-strand	441-450	10	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin-binding protein C, cardiac-type	A	protein	137	Homo sapiens	Q14896 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5K6P_1 Myosin-binding protein C, cardiac-type (chains A)
GPGSEDVWEILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQ
VSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAY
QCVVGGEKCSTELFVKE

Primary citation

A Highly Conserved Yet Flexible Linker Is Part of a Polymorphic Protein-Binding Domain in Myosin-Binding Protein C. Michie, K.A., Kwan, A.H., Tung, C.S. et al. Structure (2016) 24:2000-2007. DOI 10.1016/j.str.2016.08.018 · PubMed

Other PDB entries of the same protein (UniProt Q14896 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CX2 1.3 Å, Crystal structure of the C1 domain of cardiac isoform of myosin binding protein-C at 1.3A
2V6H 1.55 Å, Crystal structure of the C1 domain of cardiac myosin binding protein-C
7LRG 6.1 Å, Filamentous actin decorated with human cardiac myosin binding protein C C2 domain
8G4L 6.4 Å, Cryo-EM structure of the human cardiac myosin filament
7TIJ 8.0 Å, Cardiac F-actin decorated with regulatory M-domain of cardiac myosin binding protein C
7TIT 8.0 Å, Cardiac thin filament decorated with regulatory M-domain of cardiac myosin binding…
7TJ7 8.0 Å, Cardiac thin filament decorated with C1 Ig-domain and regulatory M-domain of cardiac…
6G2T 9.0 Å, human cardiac myosin binding protein C C1 Ig-domain bound to native cardiac thin filament
6CXI 11.0 Å, Cardiac thin filament decorated with C0C1 fragment of cardiac myosin binding protein C…
6CXJ 11.0 Å, Cardiac thin filament decorated with C0C1 fragment of cardiac myosin binding protein C…
1GXE Central domain of cardiac myosin binding protein C
1PD6 The NMR structure of domain C2 of human cardiac Myosin Binding Protein C

Browse structure collections

About this viewer

MolViewer shows 5K6P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.