5K8D: RFVIIIFc

Crystal structure of rFVIIIFc. Determined by X-ray diffraction at 4.19 Å resolution. Released 14 Jun 2017.

Method: X-ray diffraction
Resolution: 4.19 Å
Organism: Homo sapiens
Chains: 2
Atoms: 10,138
Mol. weight: 186.53 kDa
Ligands: CA, CU
Released: 14 Jun 2017

Explore 5K8D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5K8D contains 22 α-helices and 117 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 50 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	1
β-strand	7	1	2
β-strand	11-14	4	3
β-strand	46-49	4	3
β-strand	53	1	2
α-helix	67-69	3
β-strand	73-79	7	4
β-strand	84-86	3	1
β-strand	89	1	5
β-strand	104	1	6
α-helix	128-129	2
β-strand	133	1	5
β-strand	136-138	3	1
β-strand	139	1	6
α-helix	151	1
β-strand	154-158	5	4
β-strand	174-179	6	4
α-helix	184-189	6
β-strand	194-200	7	7
β-strand	232	1	8
β-strand	233-234	2	7
β-strand	239	1	9
β-strand	246-247	2	9
β-strand	253-260	8	7
β-strand	267-268	2	10
β-strand	269-271	3	9
β-strand	274	1	9
β-strand	276-277	2	7
β-strand	282	1	7
β-strand	287-288	2	10
β-strand	293-298	6	7
β-strand	304-310	7	9
β-strand	319	1	8
β-strand	321-326	6	9
β-strand	384-394	11	11
α-helix	409-412	4
β-strand	415	1	12
β-strand	418	1	12
β-strand	422-429	8	11
β-strand	453-456	4	13
β-strand	462-466	5	11
β-strand	476-478	3	13
β-strand	482-485	4	11
β-strand	508-514	7	11
α-helix	526	1
β-strand	530-534	5	13
α-helix	541-545	5
β-strand	549-554	6	13
β-strand	572-576	5	14
β-strand	579	1	15
α-helix	588-594	7
α-helix	606-609	4
α-helix	610-612	3
β-strand	614	1	15
β-strand	635-641	7	14
β-strand	652-653	2	16
β-strand	660-661	2	14
β-strand	665-666	2	14
β-strand	676-682	7	14
β-strand	691-692	2	16
α-helix	697-702	6

Chain B: 11 helices, 67 β-strands

Element	Residues	Length	Sheet
β-strand	1696-1707	12	17
β-strand	1730-1737	8	17
α-helix	1751-1756	6
α-helix	1760-1761	2
β-strand	1763-1766	4	18
β-strand	1770-1778	9	17
β-strand	1783	1	19
β-strand	1786-1787	2	20
β-strand	1807	1	19
β-strand	1812-1818	7	17
α-helix	1821-1823	3
β-strand	1832	1	18
β-strand	1836-1838	3	20
α-helix	1845-1849	5
β-strand	1853-1854	2	20
β-strand	1855-1858	4	18
β-strand	1874-1877	4	21
β-strand	1880-1883	4	22
α-helix	1891-1895	5
α-helix	1913-1916	4
β-strand	1918-1921	4	22
β-strand	1924-1925	2	22
β-strand	1933	1	23
β-strand	1940-1943	4	21
β-strand	1946	1	22
β-strand	1955-1958	4	23
β-strand	1963-1966	4	21
β-strand	1970-1973	4	21
β-strand	1975-1977	3	23
β-strand	1985-1988	4	21
β-strand	1994-2000	7	23
α-helix	2003-2007	5
β-strand	2009	1	22
β-strand	2011-2016	6	23
β-strand	2023-2024	2	24
α-helix	2034-2036	3
β-strand	2037-2038	2	25
β-strand	2062	1	26
β-strand	2072-2074	3	25
β-strand	2081-2083	3	24
β-strand	2085-2087	3	27
β-strand	2089-2090	2	28
β-strand	2095-2096	2	28
β-strand	2098-2106	9	25
β-strand	2113-2114	2	25
α-helix	2124-2125	2
β-strand	2126-2127	2	25
β-strand	2136-2137	2	27
β-strand	2144	1	24
β-strand	2148-2156	9	25
β-strand	2162	1	26
β-strand	2163-2164	2	27
β-strand	2167-2168	2	24
β-strand	2177	1	29
α-helix	2180-2182	3
β-strand	2190-2192	3	30
β-strand	2197	1	31
β-strand	2202	1	31
α-helix	2205-2207	3
β-strand	2209	1	32
β-strand	2219	1	33
β-strand	2230-2233	4	30
β-strand	2238-2239	2	34
β-strand	2243-2245	3	32
β-strand	2247-2249	3	35
β-strand	2254-2257	4	35
β-strand	2259-2262	4	30
β-strand	2265	1	30
β-strand	2275	1	36
β-strand	2280	1	36
β-strand	2283-2284	2	30
β-strand	2293-2295	3	32
β-strand	2305-2310	6	30
β-strand	2313-2314	2	35
β-strand	2319	1	33
β-strand	2321-2323	3	32
β-strand	2324	1	29
β-strand	2326-2327	2	34

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Coagulation factor VIII	A	protein	740	Homo sapiens	P00451 (AlphaFold model)
Coagulation factor VIII,Ig gamma-1 chain C region	B	protein	865	Homo sapiens	P00451 (AlphaFold model), P01857 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5K8D_1 Coagulation factor VIII (chains A)
ATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVYKKTLFVEFTDHLFN
IAKPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAVGVSYWKASEGAEYDDQTSQ
REKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLIGALLVCR
EGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNGYVNR
SLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLL
MDLGQFLLFCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVRF
DDDNSPSFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIG
RKYKKVRFMAYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGI
TDVRPLYSRRLPKGVKHLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNME
RDLASGLIGPLLICYKESVDQRGNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPAG
VQLEDPEFQASNIMHSINGYVFDSLQLSVCLHEVAYWYILSIGAQTDFLSVFFSGYTFKH
KMVYEDTLTLFPFSGETVFMSMENPGLWILGCHNSDFRNRGMTALLKVSSCDKNTGDYYE
DSYEDISAYLLSKNNAIEPR

Sequence of entity 2 (B), FASTA

>5K8D_2 Coagulation factor VIII,Ig gamma-1 chain C region (chains B)
KTRHYFIAAVERLWDYGMSSSPHVLRNRAQSGSVPQFKKVVFQEFTDGSFTQPLYRGELN
EHLGLLGPYIRAEVEDNIMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETK
TYFWKVQHHMAPTKDEFDCKAWAYFSDVDLEKDVHSGLIGPLLVCHTNTLNPAHGRQVTV
QEFALFFTIFDETKSWYFTENMERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPGLV
MAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEEYKMALYNLYPGVFETVEMLPSKA
GIWRVECLIGEHLHAGMSTLFLVYSNKCQTPLGMASGHIRDFQITASGQYGQWAPKLARL
HYSGSINAWSTKEPFSWIKVDLLAPMIIHGIKTQGARQKFSSLYISQFIIMYSLDGKKWQ
TYRGNSTGTLMVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNS
CSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVD
FQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPV
VNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLYDKTHTCPPCPAPELLGGPSVF
LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR
VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKN
QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN
VFSCSVMHEALHNHYTQKSLSLSPG

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	3
CU	Copper (II) ion	Cu	2

Primary citation

The structural basis for the functional comparability of factor VIII and the long-acting variant recombinant factor VIII Fc fusion protein. Leksa, N.C., Chiu, P.L., Bou-Assaf, G.M. et al. J Thromb Haemost (2017) 15:1167-1179. DOI 10.1111/jth.13700 · PubMed

Other PDB entries of the same protein (UniProt P00451 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HNY 1.07 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
3HNB 1.15 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
1D7P 1.5 Å, Crystal structure of the c2 domain of human factor viii at 1.5 a resolution at 1.5 A
9D5D 1.83 Å, Crystal Structure of Blood Coagulation Factor VIII C2 Domain Mutant L2251A/L2252A
1IQD 2.0 Å, Human Factor VIII C2 Domain complexed to human monoclonal BO2C11 Fab.
3HOB 2.07 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
4PT6 2.1 Å, The discobody: an engineered discoidin domain from factor VIII that binds v 3 integrin…
4KI5 2.47 Å, Cystal structure of human factor VIII C2 domain in a ternary complex with murine…
4XZU 2.61 Å, Crystal Structure of the Human Factor VIII C2 Domain in Complex with Murine 3E6…
7KWO 2.9 Å, Rfviiifc-vwf-xten (BIVV001)
36JL 3.15 Å, Coagulation factor VIII, full-length, membrane-bound, on Ptd-choline : Ptd-serine 75:25…
9JBV 3.17 Å, Structure of Engineered Coagulation Factor VIII with Enhanced Secretion and Coagulation…

Browse structure collections

About this viewer

MolViewer shows 5K8D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.