5KBD: Tumor protein p73

Structural Studies of Transcription Factor p73 DNA Binding Domain Bound to PA26 20-mer Response Element. Determined by X-ray diffraction at 2.8 Å resolution. Released 31 Aug 2016.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,584
Mol. weight: 53.12 kDa
Ligands: ZN
Released: 31 Aug 2016

Explore 5KBD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5KBD contains 9 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	121	1	1
β-strand	128-130	3	2
β-strand	142-145	4	1
β-strand	150-153	4	1
β-strand	158-164	7	2
α-helix	168-170	3
β-strand	174-181	8	1
α-helix	190-191	2
α-helix	195-199	5
β-strand	215-217	3	2
β-strand	224-227	4	1
β-strand	234-239	6	1
α-helix	242-244	3
β-strand	250-256	7	2
β-strand	271-278	8	1
β-strand	286-294	9	1
α-helix	298-310	13

Chain B: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	121	1	3
β-strand	128-131	4	4
β-strand	142-145	4	3
β-strand	150-154	5	3
β-strand	159-164	6	4
α-helix	168-170	3
β-strand	174-181	8	3
α-helix	190-191	2
β-strand	215-217	3	4
β-strand	224-227	4	3
β-strand	234-239	6	3
α-helix	240-244	5
β-strand	250-256	7	4
β-strand	271-278	8	3
β-strand	284-295	12	3
α-helix	298-310	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor protein p73	A, B	protein	207	Homo sapiens	O15350 (AlphaFold model)
DNA (5'-d(pgpgpapcpapapgptpcpt)-3')	C	DNA	10	Homo sapiens
DNA (5'-d(papgpapcptptpgptpcpc)-3')	D	DNA	10	Homo sapiens

Sequence of entity 1 (A, B), FASTA

>5KBD_1 Tumor protein p73 (chains A, B)
HHHHHHHEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKV
STPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQY
VDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVL
GRRSFEGRICACPGRDRKADEDHYREQ

Sequence of entity 2 (C), FASTA

>5KBD_2 DNA (5'-D(P*GP*GP*AP*CP*AP*AP*GP*TP*CP*T)-3') (chains C)
GGACAAGTCT

Sequence of entity 3 (D), FASTA

>5KBD_3 DNA (5'-D(P*AP*GP*AP*CP*TP*TP*GP*TP*CP*C)-3') (chains D)
AGACTTGTCC

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structural Studies of Transcription Factor p73 DNA Binding Domain Bound to PA26 20-mer Response Element. Nguyen, H.T., Huang, D. To be published.

Other PDB entries of the same protein (UniProt O15350 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5HOB 1.22 Å, p73 homo-tetramerization domain mutant I
5HOC 1.36 Å, p73 homo-tetramerization domain mutant II
2WQI 1.7 Å, Crystal structure of the human p73 tetramerization domain
8P9C 1.76 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…
9GNB 1.8 Å, Structure of p73 SAM domain in complex with DARPin B9
2XWC 1.82 Å, Crystal structure of the DNA binding domain of human TP73 refined at 1.8 A resolution
2WQJ 2.0 Å, Crystal structure of a truncated variant of the human p73 tetramerization domain
9GLQ 2.1 Å, Crystal structure of p73 tetramerisation domain in complex with darpins 1800
8P9E 2.25 Å, Crystal structure of wild type p63-p73 heterotetramer (tetramerisation domain) in…
4A63 2.27 Å, Crystal structure of the p73-ASPP2 complex at 2.6A resolution
2WTT 2.3 Å, Structure of the human p73 tetramerization domain (crystal form II)
1DXS 2.54 Å, Crystal structure of the C-terminal sterile alpha motif (SAM) domain of human p73 alpha…

Browse structure collections

About this viewer

MolViewer shows 5KBD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.