Crystal structure of WNK3 kinase domain in a monophosphorylated apo state. Determined by X-ray diffraction at 2.25 Å resolution. Released 28 Jun 2017.
Explore 5O23 in 3D Show helices and sheets RCSB PDB PDBe
5O23 contains 35 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 139-140 | 2 | 1 |
| β-strand | 146-155 | 10 | 1 |
| β-strand | 160-166 | 7 | 1 |
| β-strand | 172-179 | 8 | 1 |
| α-helix | 180-182 | 3 | |
| α-helix | 185-198 | 14 | |
| β-strand | 206 | 1 | 2 |
| β-strand | 209-215 | 7 | 1 |
| β-strand | 222-228 | 7 | 1 |
| β-strand | 234 | 1 | 2 |
| α-helix | 235-239 | 5 | |
| α-helix | 247-265 | 19 | |
| α-helix | 278-280 | 3 | |
| β-strand | 281-283 | 3 | 2 |
| α-helix | 286-288 | 3 | |
| β-strand | 290-292 | 3 | 2 |
| α-helix | 293-294 | 2 | |
| α-helix | 295-299 | 5 | |
| α-helix | 300-302 | 3 | |
| α-helix | 304-309 | 6 | |
| α-helix | 313-315 | 3 | |
| α-helix | 318-321 | 4 | |
| α-helix | 328-343 | 16 | |
| α-helix | 354-361 | 8 | |
| α-helix | 368-372 | 5 | |
| α-helix | 376-385 | 10 | |
| α-helix | 396-400 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 137-140 | 4 | 3 |
| β-strand | 146-155 | 10 | 3 |
| β-strand | 160-166 | 7 | 3 |
| β-strand | 171-179 | 9 | 3 |
| α-helix | 180-182 | 3 | |
| α-helix | 185-199 | 15 | |
| β-strand | 203 | 1 | 4 |
| β-strand | 206 | 1 | 4 |
| β-strand | 209-216 | 8 | 3 |
| β-strand | 221-228 | 8 | 3 |
| β-strand | 234 | 1 | 4 |
| α-helix | 235-242 | 8 | |
| α-helix | 247-265 | 19 | |
| α-helix | 278-280 | 3 | |
| β-strand | 281-283 | 3 | 4 |
| β-strand | 290-292 | 3 | 4 |
| α-helix | 293-294 | 2 | |
| α-helix | 295-299 | 5 | |
| α-helix | 300-302 | 3 | |
| α-helix | 304-309 | 6 | |
| α-helix | 313-315 | 3 | |
| α-helix | 318-321 | 4 | |
| α-helix | 328-343 | 16 | |
| α-helix | 354-361 | 8 | |
| α-helix | 368-372 | 5 | |
| α-helix | 376-385 | 10 | |
| α-helix | 390-392 | 3 | |
| α-helix | 394-395 | 2 | |
| α-helix | 396-400 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine-protein kinase WNK3 | A, B | protein | 285 | Homo sapiens | Q9BYP7 (AlphaFold model) |
>5O23_1 Serine/threonine-protein kinase WNK3 (chains A, B) SMEAEMKAVATSPSGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQDRKLTKAEQQ RFKEEAEMLKGLQHPNIVRFYDSWESILKGKKCIVLVTELMTSGTLKTYLKRFKVMKPKV LRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLMRTSFAKSV IGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGIKPAS FNKVTDPEVKEIIEGCIRQNKSERLSIRDLLNHAFFAEDTGLRVE
Crystal structure of WNK3 kinase domain in a monophosphorylated apo state. Pinkas, D.M., Daubner, G.M., Bufton, J.C. et al. To be published.
Other PDB entries of the same protein (UniProt Q9BYP7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5O23 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.