5O26: Serine/threonine-protein kinase WNK3

Crystal structure of WNK3 kinase domain in a diphosphorylated state and in complex with AMP-PNP/Mg2+. Determined by X-ray diffraction at 2.38 Å resolution. Released 28 Jun 2017.

Method: X-ray diffraction
Resolution: 2.38 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,489
Mol. weight: 66.54 kDa
Ligands: MG, ANP
Released: 28 Jun 2017

Explore 5O26 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5O26 contains 31 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	139-140	2	1
β-strand	146-155	10	1
β-strand	159-166	8	1
β-strand	171-179	9	1
α-helix	185-198	14
β-strand	206	1	2
β-strand	209-215	7	1
β-strand	222-228	7	1
β-strand	234	1	2
α-helix	235-242	8
α-helix	245-246	2
α-helix	247-265	19
β-strand	271-272	2	3
α-helix	278-280	3
β-strand	281-284	4	2
β-strand	289-292	4	2
α-helix	295-297	3
β-strand	299-300	2	3
β-strand	306	1	4
α-helix	313-315	3
α-helix	318-320	3
β-strand	325	1	4
α-helix	328-343	16
α-helix	354-362	9
α-helix	365-367	3
α-helix	368-372	5
α-helix	376-385	10
α-helix	390-392	3
α-helix	394-395	2
α-helix	396-400	5
α-helix	404-406	3

Chain B: 14 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	137-140	4	5
β-strand	146-155	10	5
β-strand	159-166	8	5
β-strand	171-178	8	5
α-helix	188-199	12
β-strand	206	1	6
β-strand	209-214	6	5
β-strand	223-228	6	5
β-strand	234	1	6
α-helix	235-242	8
α-helix	247-265	19
β-strand	271-272	2	7
α-helix	278-280	3
β-strand	281-283	3	6
β-strand	290-292	3	6
α-helix	295-297	3
β-strand	299-300	2	7
β-strand	306	1	8
α-helix	313-315	3
α-helix	318-320	3
β-strand	325	1	8
α-helix	328-343	16
α-helix	354-362	9
α-helix	368-372	5
α-helix	376-385	10
α-helix	394-395	2
α-helix	396-400	5
α-helix	403-406	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase WNK3	A, B	protein	284	Homo sapiens	Q9BYP7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5O26_1 Serine/threonine-protein kinase WNK3 (chains A, B)
SMAEMKAVATSPSGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQDRKLTKAEQQR
FKEEAEMLKGLQHPNIVRFYDSWESILKGKKCIVLVTELMTSGTLKTYLKRFKVMKPKVL
RSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLMRTSFAKSVI
GTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGIKPASF
NKVTDPEVKEIIEGCIRQNKSERLSIRDLLNHAFFAEDTGLRVE

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	2

Water and common crystallization additives (EDO) are not listed.

Primary citation

Crystal structure of WNK3 kinase domain in a diphosphorylated state and in complex with AMP-PNP/Mg2+. Pinkas, D.M., Daubner, G.M., Bufton, J.C. et al. To be published.

Other PDB entries of the same protein (UniProt Q9BYP7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5O1V 1.72 Å, Crystal structure of WNK3 kinase domain in a monophosphorylated apo state (A-loop swapped)
5O2B 2.04 Å, Crystal structure of WNK3 kinase domain in a diphosphorylated state and in a complex…
5O21 2.06 Å, Crystal structure of WNK3 kinase domain in a monophosphorylated state with chloride…
5O23 2.25 Å, Crystal structure of WNK3 kinase domain in a monophosphorylated apo state
5O2C 2.4 Å, Crystal structure of WNK3 kinase and CCT1 didomain in a unphosphorylated state
5NKP 2.8 Å, Crystal structure of the human KLHL3 Kelch domain in complex with a WNK3 peptide
8EDH 3.11 Å, Identification of a class of WNK isoform-specific inhibitors through high-throughput…
9D7Q 3.3 Å, Water and chloride as allosteric inhibitors in WNK kinase osmosensing

Browse structure collections

About this viewer

MolViewer shows 5O26 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.