5O2C: Serine/threonine-protein kinase WNK3

Crystal structure of WNK3 kinase and CCT1 didomain in a unphosphorylated state. Determined by X-ray diffraction at 2.4 Å resolution. Released 28 Jun 2017.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,096
Mol. weight: 44.09 kDa
Released: 28 Jun 2017

Explore 5O2C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5O2C contains 25 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	132-134	3
β-strand	137-140	4	1
β-strand	146-154	9	1
β-strand	159-166	8	1
β-strand	172-178	7	1
α-helix	185-197	13
α-helix	198-200	3
β-strand	206	1	2
β-strand	209-217	9	1
β-strand	220-228	9	1
β-strand	234	1	2
α-helix	235-241	7
α-helix	243-245	3
α-helix	249-265	17
α-helix	270-271	2
α-helix	278-280	3
β-strand	281-283	3	2
β-strand	290-292	3	2
α-helix	298-301	4
α-helix	304-310	7
α-helix	313-315	3
α-helix	318-321	4
α-helix	328-343	16
α-helix	354-363	10
α-helix	368-372	5
α-helix	376-385	10
α-helix	390-392	3
α-helix	394-395	2
α-helix	396-399	4
α-helix	403-405	3
β-strand	411-415	5	3
β-strand	425-432	8	3
α-helix	435-437	3
α-helix	442-443	2
β-strand	447-453	7	3
α-helix	459-469	11
α-helix	474-476	3
α-helix	477-494	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase WNK3	A	protein	380	Homo sapiens	Q9BYP7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5O2C_1 Serine/threonine-protein kinase WNK3 (chains A)
SMEKNEKEMEEEAEMKAVATSPSGRFLKFDIELGRGAFKTVYKGLDTETWVEVAWCELQD
RKLTKAEQQRFKEEAEMLKGLQHPNIVRFYDSWESILKGKKCIVLVTELMTSGTLKTYLK
RFKVMKPKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATL
MRTSFAKSVIGTPEFMAPEMYEEHYDESVDVYAFGMCMLEMATSEYPYSECQNAAQIYRK
VTSGIKPASFNKVTDPEVKEIIEGCIRQNKSERLSIRDLLNHAFFAEDTGLRVELAEEDD
CSNSSLALRLWVEDPKKLKGKHKDNEAIEFSFNLETDTPEEVAYEMVKSGFFHESDSKAV
AKSIRDRVTPIKKTREKKPA

Primary citation

Crystal structure of WNK3 kinase and CCT1 didomain in a unphosphorylated state. Pinkas, D.M., Daubner, G.M., Bufton, J.C. et al. To be published.

Other PDB entries of the same protein (UniProt Q9BYP7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5O1V 1.72 Å, Crystal structure of WNK3 kinase domain in a monophosphorylated apo state (A-loop swapped)
5O2B 2.04 Å, Crystal structure of WNK3 kinase domain in a diphosphorylated state and in a complex…
5O21 2.06 Å, Crystal structure of WNK3 kinase domain in a monophosphorylated state with chloride…
5O23 2.25 Å, Crystal structure of WNK3 kinase domain in a monophosphorylated apo state
5O26 2.38 Å, Crystal structure of WNK3 kinase domain in a diphosphorylated state and in complex with…
5NKP 2.8 Å, Crystal structure of the human KLHL3 Kelch domain in complex with a WNK3 peptide
8EDH 3.11 Å, Identification of a class of WNK isoform-specific inhibitors through high-throughput…
9D7Q 3.3 Å, Water and chloride as allosteric inhibitors in WNK kinase osmosensing

Browse structure collections

About this viewer

MolViewer shows 5O2C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.