5O2Z: Gelsolin

Domain swap dimer of the G167R variant of gelsolin second domain. Determined by X-ray diffraction at 1.7 Å resolution. Released 8 Nov 2017.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,079
Mol. weight: 27.25 kDa
Ligands: CA, FLC
Released: 8 Nov 2017

Explore 5O2Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5O2Z contains 8 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	161-167	7	2
β-strand	171-176	6	1
α-helix	180-182	3
β-strand	188-192	5	1
β-strand	196-201	6	1
α-helix	207-219	13
α-helix	220-224	5
β-strand	230-235	6	1
α-helix	241-247	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gelsolin	A, B	protein	119	Homo sapiens	P06396 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5O2Z_1 Gelsolin (chains A, B)
GSHHVVPNEVVVQRLFQVKRRRVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNR
YERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAA

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2
FLC	Citrate anion	C6 H5 O7	2

Water and common crystallization additives (ACT, NA, GOL) are not listed.

Primary citation

Gelsolin pathogenic Gly167Arg mutation promotes domain-swap dimerization of the protein. Boni, F., Milani, M., Barbiroli, A. et al. Hum Mol Genet (2018) 27:53-65. DOI 10.1093/hmg/ddx383 · PubMed

Other PDB entries of the same protein (UniProt P06396 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5FAF 1.05 Å, N184K pathological variant of gelsolin domain 2 (orthorhombic form)
6QW3 1.3 Å, Calcium-bound gelsolin domain 2
6LJE 1.4 Å, Crystal structure of gelsolin G3 domain (calcium and magnesium condition)
6LJF 1.5 Å, Crystal structure of gelsolin G3 domain (calcium condition)
2FH1 1.55 Å, C-terminal half of gelsolin soaked in low calcium at pH 4.5
3CIP 1.6 Å, Complex of Dictyostelium Discoideum Actin with Gelsolin
1KCQ 1.65 Å, Human Gelsolin Domain 2 with a Cd2+ bound
3CI5 1.7 Å, Complex of Phosphorylated Dictyostelium Discoideum Actin with Gelsolin
5FAE 1.7 Å, N184K pathological variant of gelsolin domain 2 (trigonal form)
1D4X 1.75 Å, Crystal Structure of Caenorhabditis Elegans Mg-ATP Actin Complexed with Human Gelsolin…
1NLV 1.8 Å, Crystal Structure Of Dictyostelium Discoideum Actin Complexed With Ca ATP And Human…
1NM1 1.8 Å, Crystal Structure of D. Dicsoideum Actin Complexed With Gelsolin Segment 1 and Mg ATP at…

Browse structure collections

About this viewer

MolViewer shows 5O2Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.