5OQ9: PDB entry 5OQ9

Name: PDB 5OQ9: XFEL structure of the off state of a reversibly photoswitching fluorescent protein determined using the droplet on demand injection method
Published: 2017-12-06
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: fluorescent protein

XFEL structure of the off state of a reversibly photoswitching fluorescent protein determined using the droplet on demand injection method. Determined by X-ray diffraction at 1.51 Å resolution. Released 6 Dec 2017.

Method: X-ray diffraction
Resolution: 1.51 Å
Organism: Lobophyllia hemprichii
Chains: 1
Atoms: 1,991
Mol. weight: 25.72 kDa
Released: 6 Dec 2017

Explore 5OQ9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5OQ9 contains 8 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	8-18	11	1
β-strand	21-32	12	1
α-helix	33-35	3
β-strand	37-46	10	1
α-helix	48	1
α-helix	50	1
α-helix	54-60	7
β-strand	70	1	1
α-helix	78-81	4
β-strand	87-95	9	1
β-strand	100-110	11	1
β-strand	113-123	11	1
α-helix	130-133	4
β-strand	136-139	4	1
α-helix	140-141	2
β-strand	142-149	8	1
β-strand	152-163	12	1
β-strand	167-179	13	1
α-helix	184-187	4
β-strand	190-201	12	1
β-strand	207-217	11	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Green to red photoconvertible GFP-like protein EosFP	A	protein	224	Lobophyllia hemprichii	Q5S6Z9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5OQ9_1 Green to red photoconvertible GFP-like protein EosFP (chains A)
MSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTA
FLYGNRVFAKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRF
YGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDVEMALLLEGNAHYRCDFRTTYKAK
EKGVKLPGAHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Primary citation

X-ray Free Electron Laser Determination of Crystal Structures of Dark and Light States of a Reversibly Photoswitching Fluorescent Protein at Room Temperature. Hutchison, C.D.M., Cordon-Preciado, V., Morgan, R.M.L. et al. Int J Mol Sci (2017) 18. DOI 10.3390/ijms18091918 · PubMed

Other PDB entries of the same protein (UniProt Q5S6Z9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7QLJ 1.02 Å, Trans structure of rsKiiro Illuminated at 290 K
7QLI 1.16 Å, Cis structure of rsKiiro at 290 K
7QLM 1.3 Å, rsKiiro trans chromophore dark structure by SFX
7QLO 1.31 Å, rsKiiro pump dump probe structure by TR-SFX
7QLL 1.32 Å, rsKiiro Thermal annealing at 290K of 200K Cis intermediate
9J0Q 1.34 Å, Structure of mEos3.2 in the green fluorescent state
7QLK 1.46 Å, Cis structure intermediate of rsKiiro Illuminated at 200 K
6GP0 1.5 Å, Structure of mEos4b in the red fluorescent state
7QLN 1.5 Å, rsKiiro pump probe structure by TR-SFX
6GP1 1.5 Å, Structure of mEos4b in the red long-lived dark state
5OQA 1.53 Å, XFEL structure of the off state of a reversibly photoswitching fluorescent protein…
6YLS 1.55 Å, mEos4b - Directionality of Optical Properties of Fluorescent Proteins

Browse structure collections

About this viewer

MolViewer shows 5OQ9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.