7QLI: Cis structure of rsKiiro at 290 K

Name: PDB 7QLI: Cis structure of rsKiiro at 290 K
Published: 2023-07-05
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: fluorescent protein

Cis structure of rsKiiro at 290 K. Determined by X-ray diffraction at 1.16 Å resolution. Released 5 Jul 2023.

Method: X-ray diffraction
Resolution: 1.16 Å
Organism: Lobophyllia hemprichii
Chains: 1
Atoms: 2,208
Mol. weight: 25.53 kDa
Released: 5 Jul 2023

Explore 7QLI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7QLI contains 8 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	8-18	11	1
β-strand	21-32	12	1
α-helix	33-35	3
β-strand	37-46	10	1
α-helix	48	1
α-helix	50	1
α-helix	54-60	7
β-strand	70	1	1
α-helix	80-82	3
β-strand	87-95	9	1
β-strand	100-110	11	1
β-strand	113-123	11	1
α-helix	130-133	4
β-strand	136-139	4	1
α-helix	140-141	2
β-strand	142-149	8	1
β-strand	152-163	12	1
β-strand	167-179	13	1
α-helix	184-188	5
β-strand	190-201	12	1
β-strand	207-217	11	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
rsKiiro	A	protein	220	Lobophyllia hemprichii	Q5S6Z9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7QLI_1 rsKiiro (chains A)
MSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTA
FAYGNRVFAKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICNARNDITMEGDTFYNKVRF
YGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDVETALLLEGNAHYRCDFRTTYKAK
EKGVKLPGAHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPN

Primary citation

Optical control of ultrafast structural dynamics in a fluorescent protein. Hutchison, C.D.M., Baxter, J.M., Fitzpatrick, A. et al. Nat Chem (2023) 15:1607-1615. DOI 10.1038/s41557-023-01275-1 · PubMed

Other PDB entries of the same protein (UniProt Q5S6Z9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7QLJ 1.02 Å, Trans structure of rsKiiro Illuminated at 290 K
7QLM 1.3 Å, rsKiiro trans chromophore dark structure by SFX
7QLO 1.31 Å, rsKiiro pump dump probe structure by TR-SFX
7QLL 1.32 Å, rsKiiro Thermal annealing at 290K of 200K Cis intermediate
9J0Q 1.34 Å, Structure of mEos3.2 in the green fluorescent state
7QLK 1.46 Å, Cis structure intermediate of rsKiiro Illuminated at 200 K
6GP0 1.5 Å, Structure of mEos4b in the red fluorescent state
7QLN 1.5 Å, rsKiiro pump probe structure by TR-SFX
6GP1 1.5 Å, Structure of mEos4b in the red long-lived dark state
5OQ9 1.51 Å, XFEL structure of the off state of a reversibly photoswitching fluorescent protein…
5OQA 1.53 Å, XFEL structure of the off state of a reversibly photoswitching fluorescent protein…
6YLS 1.55 Å, mEos4b - Directionality of Optical Properties of Fluorescent Proteins

Browse structure collections

About this viewer

MolViewer shows 7QLI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.