9J0Q: MEos3.2 in the green fluorescent state

Name: PDB 9J0Q: Structure of mEos3.2 in the green fluorescent state
Published: 2025-04-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: fluorescent protein

Structure of mEos3.2 in the green fluorescent state. Determined by X-ray diffraction at 1.34 Å resolution. Released 16 Apr 2025.

Method: X-ray diffraction
Resolution: 1.34 Å
Organism: Lobophyllia hemprichii
Chains: 1
Atoms: 2,035
Mol. weight: 28.73 kDa
Released: 16 Apr 2025

Explore 9J0Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9J0Q contains 6 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	8-18	11	1
β-strand	21-32	12	1
β-strand	37-46	10	1
α-helix	48	1
α-helix	50	1
α-helix	54-60	7
β-strand	70	1	1
α-helix	80-82	3
β-strand	87-95	9	1
β-strand	100-110	11	1
β-strand	113-123	11	1
β-strand	136-139	4	1
α-helix	140-141	2
β-strand	142-149	8	1
β-strand	152-163	12	1
β-strand	167-179	13	1
α-helix	184-188	5
β-strand	190-201	12	1
β-strand	207-217	11	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Green to red photoconvertible GFP-like protein EosFP	A	protein	248	Lobophyllia hemprichii	Q5S6Z9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9J0Q_1 Green to red photoconvertible GFP-like protein EosFP (chains A)
MGSSHHHHHHSQDPLEVLFQGPEFMSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEG
KQSMDLEVKEGGPLPFAFDILTTAFXNRVFAKYPDNIQDYFKQSFPKGYSWERSLTFEDG
GICNARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIE
MALLLEGNAHYRCDFRTTYKAKEKGVKLPGAHFVDHCIEILSHDKDYNKVKLYEHAVAHS
GLPDNARR

Primary citation

Structural basis for the fast maturation of pcStar, a photoconvertible fluorescent protein. Zheng, S., Shi, X., Lin, J. et al. Acta Crystallogr D Struct Biol (2025) 81:181-195. DOI 10.1107/S2059798325002141 · PubMed

Other PDB entries of the same protein (UniProt Q5S6Z9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7QLJ 1.02 Å, Trans structure of rsKiiro Illuminated at 290 K
7QLI 1.16 Å, Cis structure of rsKiiro at 290 K
7QLM 1.3 Å, rsKiiro trans chromophore dark structure by SFX
7QLO 1.31 Å, rsKiiro pump dump probe structure by TR-SFX
7QLL 1.32 Å, rsKiiro Thermal annealing at 290K of 200K Cis intermediate
7QLK 1.46 Å, Cis structure intermediate of rsKiiro Illuminated at 200 K
6GP0 1.5 Å, Structure of mEos4b in the red fluorescent state
7QLN 1.5 Å, rsKiiro pump probe structure by TR-SFX
6GP1 1.5 Å, Structure of mEos4b in the red long-lived dark state
5OQ9 1.51 Å, XFEL structure of the off state of a reversibly photoswitching fluorescent protein…
5OQA 1.53 Å, XFEL structure of the off state of a reversibly photoswitching fluorescent protein…
6YLS 1.55 Å, mEos4b - Directionality of Optical Properties of Fluorescent Proteins

Browse structure collections

About this viewer

MolViewer shows 9J0Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.