7QLO: RsKiiro pump dump probe structure by TR-SFX

Name: PDB 7QLO: rsKiiro pump dump probe structure by TR-SFX
Published: 2023-10-18
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: fluorescent protein

rsKiiro pump dump probe structure by TR-SFX. Determined by X-ray diffraction at 1.31 Å resolution. Released 18 Oct 2023.

Method: X-ray diffraction
Resolution: 1.31 Å
Organism: Lobophyllia hemprichii
Chains: 1
Atoms: 2,074
Mol. weight: 25.15 kDa
Released: 18 Oct 2023

Explore 7QLO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7QLO contains 6 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	8-18	11	1
β-strand	21-32	12	1
β-strand	37-46	10	1
α-helix	48	1
α-helix	50	1
α-helix	54-60	7
β-strand	68	1	1
α-helix	78-80	3
β-strand	85-93	9	1
β-strand	98-108	11	1
β-strand	111-121	11	1
β-strand	134-137	4	1
α-helix	138-139	2
β-strand	140-147	8	1
β-strand	150-161	12	1
β-strand	165-177	13	1
α-helix	182-186	5
β-strand	188-199	12	1
β-strand	205-215	11	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
rsKiiro	A	protein	220	Lobophyllia hemprichii	Q5S6Z9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7QLO_1 rsKiiro (chains A)
MSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTA
FXNRVFAKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICNARNDITMEGDTFYNKVRFYG
TNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDVETALLLEGNAHYRCDFRTTYKAKEK
GVKLPGAHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPN

Primary citation

Optical control of ultrafast structural dynamics in a fluorescent protein. Hutchison, C.D.M., Baxter, J.M., Fitzpatrick, A. et al. Nat Chem (2023) 15:1607-1615. DOI 10.1038/s41557-023-01275-1 · PubMed

Other PDB entries of the same protein (UniProt Q5S6Z9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7QLJ 1.02 Å, Trans structure of rsKiiro Illuminated at 290 K
7QLI 1.16 Å, Cis structure of rsKiiro at 290 K
7QLM 1.3 Å, rsKiiro trans chromophore dark structure by SFX
7QLL 1.32 Å, rsKiiro Thermal annealing at 290K of 200K Cis intermediate
9J0Q 1.34 Å, Structure of mEos3.2 in the green fluorescent state
7QLK 1.46 Å, Cis structure intermediate of rsKiiro Illuminated at 200 K
6GP0 1.5 Å, Structure of mEos4b in the red fluorescent state
7QLN 1.5 Å, rsKiiro pump probe structure by TR-SFX
6GP1 1.5 Å, Structure of mEos4b in the red long-lived dark state
5OQ9 1.51 Å, XFEL structure of the off state of a reversibly photoswitching fluorescent protein…
5OQA 1.53 Å, XFEL structure of the off state of a reversibly photoswitching fluorescent protein…
6YLS 1.55 Å, mEos4b - Directionality of Optical Properties of Fluorescent Proteins

Browse structure collections

About this viewer

MolViewer shows 7QLO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.