5T04: Constitutively active neurotensin receptor

Structure of constitutively active neurotensin receptor. Determined by X-ray diffraction at 3.3 Å resolution. Released 21 Dec 2016.

Method: X-ray diffraction
Resolution: 3.3 Å
Organisms: Rattus norvegicus, Enterobacteria phage T4
Chains: 2
Atoms: 3,703
Mol. weight: 59.09 kDa
Ligands: TCE
Released: 21 Dec 2016

Explore 5T04 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5T04 contains 26 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	53-55	3
α-helix	61-89	29
α-helix	102-115	14
α-helix	116-120	5
α-helix	121-124	4
α-helix	125-130	6
α-helix	138-171	34
α-helix	183-200	18
α-helix	204-207	4
β-strand	208-212	5	1
β-strand	223-227	5	1
α-helix	231-241	11
α-helix	242-247	6
α-helix	248-1010	30
β-strand	1014-1015	2	2
β-strand	1016	1	3
β-strand	1017-1019	3	2
β-strand	1025-1028	4	2
β-strand	1031-1034	4	2
α-helix	1039-1045	7
β-strand	1057	1	3
α-helix	1060-1079	20
α-helix	1085-1090	6
α-helix	1093-1106	14
α-helix	1108-1113	6
α-helix	1116-1122	7
α-helix	1126-1133	8
α-helix	1137-1141	5
α-helix	1143-1155	13
α-helix	1159-1161	3
α-helix	297-333	37
α-helix	336-338	3
α-helix	341-368	28
α-helix	369-371	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neurotensin receptor type 1,Endolysin,Neurotensin receptor type 1	A	protein	513	Rattus norvegicus, Enterobacteria phage T4	P00720, P20789 (AlphaFold model)
Arg-arg-pro-tyr-ile-leu	B	protein	6	Rattus norvegicus	P20068 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5T04_1 Neurotensin receptor type 1,Endolysin,Neurotensin receptor type 1 (chains A)
DYKDDDDATSTSESDTAGPNSDLDVNTDIYSKVLVTAIYLALFVVGTVGNSVTLFTLARK
KSLQSLQSTVHYHLGSLALSDLLILLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDAC
TYATALNVASLSVERYLAICHPFKAKTLMSRSRTKKFISAIWLASALLAIPMLFTMGLQN
RSADGTHPGGLVCTPIVDTATVKVVIQVNTFMSFLFPMLVISILNTVIANKLTVMVNIFE
MLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEK
LFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLNNKR
WDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYGSGSPGRVQALRHGVLVLRAVVIA
FVVCWLPYHVRRLMFCYISDEQWTTFLFDFYHYFYMLTNALAYASSAINPILYNLVSANF
RQVFLSTLACLCPGWRHRRKAHHHHHHHHHHGG

Sequence of entity 2 (B), FASTA

>5T04_2 ARG-ARG-PRO-TYR-ILE-LEU (chains B)
RRPYIL

Ligands and cofactors

ID	Name	Formula	Copies
TCE	3,3',3''-phosphanetriyltripropanoic acid	C9 H15 O6 P	1

Water and common crystallization additives (PEG, GOL) are not listed.

Primary citation

Structure and dynamics of a constitutively active neurotensin receptor. Krumm, B.E., Lee, S., Bhattacharya, S. et al. Sci Rep (2016) 6:38564-38564. DOI 10.1038/srep38564 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…

Browse structure collections

About this viewer

MolViewer shows 5T04 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.