5T5F: Neisseria meningitidis factor H binding protein

Neisseria meningitidis factor H binding protein in complex with monoclonal antibody JAR5. Determined by X-ray diffraction at 2.98 Å resolution. Released 9 Nov 2016.

Method: X-ray diffraction
Resolution: 2.98 Å
Organisms: Neisseria meningitidis, Mus musculus
Chains: 3
Atoms: 5,057
Mol. weight: 73.91 kDa
Released: 9 Nov 2016

Explore 5T5F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5T5F contains 19 α-helices and 64 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	34-35	2	1
β-strand	45-50	6	2
β-strand	53-57	5	2
α-helix	61	1
β-strand	62-63	2	1
α-helix	65-67	3
α-helix	69	1
β-strand	73-84	12	2
β-strand	87-100	14	2
β-strand	104-115	12	2
β-strand	123-136	14	2
β-strand	138	1	3
α-helix	139	1
β-strand	140	1	4
α-helix	141-143	3
β-strand	149-158	10	3
β-strand	161-171	11	3
β-strand	176-182	7	3
α-helix	187-189	3
β-strand	192-200	9	3
β-strand	205	1	4
β-strand	206-214	9	3
β-strand	217-227	11	3
β-strand	233-242	10	3
β-strand	245-254	10	3

Chain H: 6 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	5
β-strand	9-11	3	6
β-strand	17-25	9	5
α-helix	29-31	3
β-strand	32-39	8	6
β-strand	46-51	6	6
β-strand	58-60	3	6
α-helix	62-64	3
β-strand	68-73	6	5
α-helix	74-76	3
β-strand	78-84	7	5
α-helix	88-90	3
β-strand	92-100	9	6
β-strand	108-112	5	6
β-strand	116-119	4	6
β-strand	126	1	7
β-strand	129-133	5	8
β-strand	144-154	11	8
β-strand	155	1	7
β-strand	160-163	4	9
β-strand	172-180	9	8
β-strand	183-193	11	8
α-helix	196-199	4
β-strand	204-208	5	9
α-helix	209-211	3
β-strand	213-217	5	9

Chain L: 7 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	10
β-strand	10-13	4	11
β-strand	19-24	6	12
β-strand	25	1	10
β-strand	30	1	13
β-strand	36	1	13
β-strand	38-43	6	11
β-strand	50-54	5	11
β-strand	58-59	2	11
α-helix	60	1
β-strand	67-71	5	12
β-strand	75-80	6	12
α-helix	85-87	3
β-strand	89-95	7	11
α-helix	101	1
β-strand	102-103	2	11
β-strand	104	1	10
β-strand	107-111	5	11
β-strand	116	1	14
β-strand	119-123	5	15
α-helix	124-126	3
α-helix	127-130	4
β-strand	134-144	11	15
β-strand	145	1	14
β-strand	149-156	8	16
β-strand	158-160	3	16
β-strand	164-168	5	15
α-helix	169-172	4
β-strand	178-187	10	15
α-helix	188-192	5
β-strand	196-203	8	16
β-strand	206-215	10	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Factor H binding protein variant B24	A	protein	253	Neisseria meningitidis	Q9JXV4 (AlphaFold model)
Monoclonal antibody Jar5 heavy chain	H	protein	212	Mus musculus
Monoclonal antibody Jar5 light chain	L	protein	216	Mus musculus

Sequence of entity 1 (A), FASTA

>5T5F_1 Factor H binding protein variant B24 (chains A)
GGGGVAADIGAGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSL
NTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKM
VAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEH
LKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTV
NGIRHIGLAAKQL

Sequence of entity 2 (H), FASTA

>5T5F_2 Monoclonal antibody Jar5 heavy chain (chains H)
QVQMQQPGAELVKPGASVKLSCKASGYTFISYWMHWVKQRPGRGLEWIGRIAPDTGIIYY
NEKFKNKATLTVDTPSSTAYMQLNSLTSEDSAVYYCARYLKYDGSTYRFDYWGQGTTLTV
SSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTL
SSSVTVPSSPWPSETVTCNVAHPASSTKVDKK

Sequence of entity 3 (L), FASTA

>5T5F_3 Monoclonal antibody Jar5 light chain (chains L)
DIVMTQAAPSVPVTPGESVSISCRSSKSLLHSNGNTYLFWFLQRPGQSPQLLIYRMSNLA
SGVPDRFSGSGSGTSFTLRISRVEAEDVGVYYCMQHLEYPYTFGGGTKLEIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR

Primary citation

Neisseria meningitidis factor H-binding protein bound to monoclonal antibody JAR5: implications for antibody synergy. Malito, E., Lo Surdo, P., Veggi, D. et al. Biochem J (2016) 473:4699-4713. DOI 10.1042/BCJ20160806 · PubMed

Other PDB entries of the same protein (UniProt Q9JXV4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8UP2 1.6 Å, Murine Fab JAR 4 bound to meningococcal Factor H binding protein
5NQZ 1.63 Å, Structure of a fHbp(V1.1):PorA(P1.16) chimera. Fusion at fHbp position 309.
7LCV 1.7 Å, Factor H enhancing human antibody fragment (Fab) to meningococcal Factor H binding protein
2YPV 1.8 Å, Crystal structure of the Meningococcal vaccine antigen factor H binding protein in…
2Y7S 1.9 Å, Structure of a designed meningococcal antigen (factor H binding protein, mutant G1)…
7KET 2.0 Å, Factor H enhancing human antibody fragment (Fab) to meningococcal Factor H binding protein
5O14 2.19 Å, Co-crystal structure of a cross-reactive bactericidal human antibody targeting…
2W80 2.35 Å, Structure of a complex between Neisseria meningitidis factor H binding protein and CCPs…
2W81 2.35 Å, Structure of a complex between Neisseria meningitidis factor H binding protein and CCPs…
4AYD 2.4 Å, Structure of a complex between CCPs 6 and 7 of Human Complement Factor H and Neisseria…
6XZW 2.4 Å, Crystal structure of the meningococcal vaccine antigen fHbp in complex with a…
4AYE 2.8 Å, Structure of a complex between CCPs 6 and 7 of Human Complement Factor H and Neisseria…

Browse structure collections

About this viewer

MolViewer shows 5T5F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.