Crystal structure of galectin-8N in complex with Glycerol. Determined by X-ray diffraction at 1.58 Å resolution. Released 4 Jan 2017.
Explore 5T7U in 3D Show helices and sheets RCSB PDB PDBe
5T7U contains 3 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-13 | 5 | 1 |
| α-helix | 15-16 | 2 | |
| β-strand | 19-22 | 4 | 2 |
| β-strand | 32-38 | 7 | 1 |
| β-strand | 45-51 | 7 | 2 |
| β-strand | 56 | 1 | 3 |
| β-strand | 59 | 1 | 3 |
| α-helix | 60-61 | 2 | |
| β-strand | 62-69 | 8 | 2 |
| β-strand | 75-82 | 8 | 2 |
| β-strand | 85-86 | 2 | 2 |
| β-strand | 90-92 | 3 | 2 |
| β-strand | 102-109 | 8 | 1 |
| β-strand | 113-118 | 6 | 1 |
| β-strand | 121-127 | 7 | 1 |
| α-helix | 132-134 | 3 | |
| β-strand | 137-142 | 6 | 2 |
| β-strand | 145-152 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Galectin-8 | A | protein | 155 | Homo sapiens | O00214 (AlphaFold model) |
>5T7U_1 Galectin-8 (chains A) MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSVKPRA DVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNG KHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSS
Structure-based rationale for differential recognition of lacto- and neolacto- series glycosphingolipids by the N-terminal domain of human galectin-8. Bohari, M.H., Yu, X., Zick, Y. et al. Sci Rep (2016) 6:39556-39556. DOI 10.1038/srep39556 · PubMed
Other PDB entries of the same protein (UniProt O00214 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5T7U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.