HTRA2 G399S mutant. Determined by X-ray diffraction at 1.7 Å resolution. Released 25 Oct 2017.
Explore 5TNY in 3D Show helices and sheets RCSB PDB PDBe
5TNY contains 12 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 144-147 | 4 | |
| α-helix | 149-157 | 9 | |
| α-helix | 158-160 | 3 | |
| β-strand | 161-170 | 10 | 1 |
| β-strand | 175-188 | 14 | 1 |
| β-strand | 192-195 | 4 | 1 |
| α-helix | 197-200 | 4 | |
| β-strand | 205-209 | 5 | 1 |
| β-strand | 215-224 | 10 | 1 |
| β-strand | 229-233 | 5 | 1 |
| α-helix | 239-241 | 3 | |
| β-strand | 245 | 1 | 2 |
| α-helix | 248-250 | 3 | |
| α-helix | 251-252 | 2 | |
| β-strand | 256-259 | 4 | 2 |
| β-strand | 271-275 | 5 | 2 |
| α-helix | 294 | 1 | |
| β-strand | 295-297 | 3 | 2 |
| β-strand | 309-311 | 3 | 2 |
| β-strand | 317-326 | 10 | 2 |
| β-strand | 329-334 | 6 | 2 |
| α-helix | 335-342 | 8 | |
| β-strand | 360-361 | 2 | 3 |
| β-strand | 364-368 | 5 | 4 |
| α-helix | 371-380 | 10 | |
| β-strand | 391-396 | 6 | 4 |
| α-helix | 401-405 | 5 | |
| β-strand | 412-416 | 5 | 4 |
| β-strand | 420 | 1 | 4 |
| α-helix | 424-431 | 8 | |
| β-strand | 437-441 | 5 | 4 |
| β-strand | 448-452 | 5 | 4 |
| β-strand | 455-456 | 2 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine protease HTRA2, mitochondrial | A | protein | 332 | Homo sapiens | O43464 (AlphaFold model) |
>5TNY_1 Serine protease HTRA2, mitochondrial (chains A) MAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGL IVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVR QGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVN LDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPS ILAELQLREPSFPDVQHGVLIHKVILSSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVR TQSQLAVQIRRGRETLTLYVTPEVTEHHHHHH
Molecular motion regulates the activity of the Mitochondrial Serine Protease HtrA2. Merski, M., Moreira, C., Abreu, R.M. et al. Cell Death Dis (2017) 8:e3119-e3119. DOI 10.1038/cddis.2017.487 · PubMed
Other PDB entries of the same protein (UniProt O43464 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5TNY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.