5TSC: Lpg2147 from Legionella pneumophila

The crystal structure of Lpg2147 from Legionella pneumophila. Determined by X-ray diffraction at 2.01 Å resolution. Released 23 Nov 2016.

Method: X-ray diffraction
Resolution: 2.01 Å
Organism: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Chains: 2
Atoms: 6,535
Mol. weight: 105.57 kDa
Released: 23 Nov 2016

Explore 5TSC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5TSC contains 46 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	10-24	15
α-helix	25-29	5
α-helix	33-42	10
α-helix	45-47	3
α-helix	54-64	11
α-helix	70-71	2
α-helix	74-96	23
α-helix	98-99	2
β-strand	100-101	2	1
α-helix	107-110	4
β-strand	118-127	10	1
β-strand	132-135	4	2
α-helix	138-140	3
α-helix	147	1
β-strand	150-153	4	2
β-strand	158-161	4	2
β-strand	167-169	3	2
α-helix	174-183	10
α-helix	187-189	3
β-strand	191-193	3	2
α-helix	205-222	18
β-strand	227-237	11	1
β-strand	249-251	3	1
β-strand	254	1	3
β-strand	258	1	3
α-helix	260-265	6
α-helix	268-273	6
α-helix	276-289	14
α-helix	293-304	12
α-helix	306	1
α-helix	316-318	3
β-strand	324-332	9	1
α-helix	335-352	18
α-helix	358-381	24

Chain B: 24 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	9-24	16
α-helix	25-29	5
α-helix	33-42	10
α-helix	45-47	3
α-helix	54-64	11
α-helix	70-71	2
α-helix	74-86	13
α-helix	88-96	9
α-helix	98-99	2
β-strand	100-101	2	4
α-helix	102-103	2
α-helix	107-110	4
β-strand	118-127	10	4
β-strand	132-135	4	5
α-helix	138-140	3
α-helix	147	1
β-strand	150-153	4	5
β-strand	158-161	4	5
β-strand	167-169	3	5
α-helix	174-183	10
α-helix	187-190	4
β-strand	191-193	3	5
α-helix	206-221	16
β-strand	227-237	11	4
β-strand	249-251	3	4
β-strand	254	1	6
β-strand	258	1	6
α-helix	260-265	6
α-helix	268-273	6
α-helix	277-289	13
α-helix	293-304	12
α-helix	306	1
α-helix	316-318	3
β-strand	324-332	9	4
α-helix	335-352	18
α-helix	358-381	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Uncharacterized protein	A, B	protein	463	Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)	Q5ZTL4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5TSC_1 Uncharacterized protein (chains A, B)
GMTTSKLEKTGLHVHEKIKHMVKNYGTMITGIPAEILGQNEAEISVGYVKKMGNMKENIA
EVVRKSEMTQPTNSAGKASNEVCDLLLGTEGASEFEKSSYQVLSGDGSNLKGSLPNKNLL
VRVEMDRFNAPQKYQKIKREEFNPETAEKNKIYLLEDQLVYLDIFGKVIDLGQTSDTCHR
LFNAITTPFYQNYILYDEYIDPEESAEEAAMFEMGEIVKAKMKNIDCWTATHSFTIFVPE
SDSEDTRTLYPYQAYWTSHTLQQWFSGDKDEKLSRLGIDGYIEKLALLGTTTDSKIRSSI
YGELFSPPGKEHVFCTGMNEKFSPLRVKFKVTEVNPEIALQNLEEVQEFIDTNYPGENAK
DQCELYKIKAQEAMTKQLEMRLLIEPTHRKESVTPYKEKNTQSFFSKNLDTTSRIDKMIS
SVITMENLKILAKEADTLSGKDREKLVEYFKTLPSEQLAEIKA

Primary citation

The crystal structure of Lpg2147 from Legionella pneumophila. Valleau, D. To be published.

Other PDB entries of the same protein (UniProt Q5ZTL4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6P5H 1.53 Å, Structure of MavC middle insertion domain
6ULH 1.97 Å, Structure of MavC in complex with its substrate in R3 spacegroup
6K3B 1.97 Å, Crystal structure of Lpg2147-Lpg2149 complex
6P5B 2.1 Å, Crystal Structure of MavC in Complex with Ub-UbE2N
6UMS 2.34 Å, Crystal structure of MavC in complex with its substrate mimic in C222(1) space group
6KG6 2.39 Å, Crystal structure of MavC/UBE2N-Ub complex
7BXH 2.7 Å, MavC-Lpg2149 complex
7BXG 2.71 Å, MavC-UBE2N-Ub complex
6UMP 2.8 Å, Crystal structure of MavC in complex with substrate mimic in P65 space group
6KL4 2.85 Å, Crystal structure of MavC-UBE2N-Ub
6KFP 2.92 Å, Crystal structure of MavC ternary complex

Browse structure collections

About this viewer

MolViewer shows 5TSC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.