5TYT: PDZ domain of RhoGEF

Crystal Structure of the PDZ domain of RhoGEF bound to CXCR2 C-terminal peptide. Determined by X-ray diffraction at 2.4 Å resolution. Released 22 Feb 2017.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,619
Mol. weight: 37.42 kDa
Released: 22 Feb 2017

Explore 5TYT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5TYT contains 10 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	41-51	11	1
β-strand	53	1	2
β-strand	56	1	2
β-strand	59-62	4	1
β-strand	68-72	5	1
α-helix	77-80	4
β-strand	88-92	5	1
β-strand	95-96	2	1
α-helix	102-110	9
β-strand	114-124	11	1
β-strand	125-127	3	3

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	41-51	11	4
α-helix	52	1
β-strand	53	1	5
β-strand	56	1	5
β-strand	59-62	4	4
β-strand	68-72	5	4
α-helix	77-81	5
β-strand	88-92	5	4
β-strand	95-96	2	4
α-helix	102-110	9
β-strand	114-124	11	4

Chain C: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	44-51	8	3
β-strand	53	1	6
β-strand	56	1	6
β-strand	59-62	4	3
β-strand	68-72	5	3
α-helix	77-80	4
β-strand	88-92	5	3
β-strand	95-96	2	3
α-helix	102-110	9
β-strand	114-121	8	3
β-strand	125-127	3	7

Chain D: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	41-51	11	7
β-strand	59-62	4	7
β-strand	68-72	5	7
α-helix	77-81	5
α-helix	87	1
β-strand	88-92	5	7
β-strand	95-96	2	7
α-helix	102-109	8
β-strand	114-124	11	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rho guanine nucleotide exchange factor 11, C-X-C chemokine receptor type 2 chimera	A, B, C, D	protein	89	Homo sapiens	O15085 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5TYT_1 Rho guanine nucleotide exchange factor 11, C-X-C chemokine receptor type 2 chimera (chains A, B, C, D)
MTGLVQRCVIIQKDQHGFGFTVSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTN
SSHLEVVKLIKSGAYVALTLLGSSTSTTL

Primary citation

Structural basis of PDZ-mediated chemokine receptor CXCR2 scaffolding by guanine nucleotide exchange factor PDZ-RhoGEF. Spellmon, N., Holcomb, J., Niu, A. et al. Biochem Biophys Res Commun (2017) 485:529-534. DOI 10.1016/j.bbrc.2017.02.010 · PubMed

Other PDB entries of the same protein (UniProt O15085 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1HTJ 2.2 Å, Structure of the rgs-like domain from PDZ-rhogef
5JHH 2.3 Å, Crystal structure of the ternary complex between the human RhoA, its inhibitor and the…
1XCG 2.5 Å, Crystal Structure of Human RhoA in complex with DH/PH fragment of PDZRHOGEF
5JHG 2.5 Å, Crystal structure of the complex between the human RhoA and the DH/PH domain of human…
3KZ1 2.7 Å, Crystal Structure of the Complex of PDZ-RhoGEF DH/PH domains with GTP-gamma-S Activated…
3T06 2.84 Å, Crystal Structure of the DH/PH fragment of PDZRHOGEF with N-terminal regulatory elements…
5E6P 3.21 Å, PlexinB2 cytoplasmic region/PDZ-RhoGEF PDZ domain complex
2DLS Solution structure of the PDZ domain of human Rho guanine nucleotide exchange factor 11

Browse structure collections

About this viewer

MolViewer shows 5TYT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.