5U1M: IRS-1 PTB Domain

Structure of the IRS-1 PTB Domain Bound to the Juxtamembrane Region of the Insulin Receptor. Determined by X-ray diffraction at 1.8 Å resolution. Released 13 Sept 2017.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,025
Mol. weight: 12.92 kDa
Released: 13 Sept 2017

Explore 5U1M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5U1M contains 3 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	162-172	11	1
α-helix	173-176	4
β-strand	181-187	7	1
β-strand	191-196	6	1
β-strand	204-207	4	1
α-helix	208-210	3
β-strand	211-217	7	1
β-strand	220-225	6	1
β-strand	234-239	6	1
α-helix	243-262	20

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1002-1005	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin receptor substrate 1	A	protein	105	Homo sapiens	P35568 (AlphaFold model)
Insulin receptor	B	protein	10	Homo sapiens	P06213 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5U1M_1 Insulin receptor substrate 1 (chains A)
KEVWQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENF
FFIEVGRSAVTGPGEFWMQVDDSVVAQNMHETILEAMRAMSDAFR

Sequence of entity 2 (B), FASTA

>5U1M_2 Insulin receptor (chains B)
XLYASSNPAY

Primary citation

Domain-dependent effects of insulin and IGF-1 receptors on signalling and gene expression. Cai, W., Sakaguchi, M., Kleinridders, A. et al. Nat Commun (2017) 8:14892-14892. DOI 10.1038/ncomms14892 · PubMed

Other PDB entries of the same protein (UniProt P35568 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PPM 1.48 Å, SHP2 catalytic domain in complex with IRS1 (889-901) phosphopeptide (pSer-892, pTyr-896)
7PPL 1.53 Å, SHP2 catalytic domain in complex with IRS1 (625-639) phosphopeptide (pTyr-632, pSer-636)
1K3A 2.1 Å, Structure of the Insulin-like Growth Factor 1 Receptor Kinase
1QQG 2.3 Å, Crystal structure of the PH-ptb targeting region of irs-1
6BNT 3.2 Å, Crystal structure of AP2 mu1 adaptin C-terminal domain with IRS-1 peptide
2Z8C 3.25 Å, Phosphorylated insulin receptor tyrosine kinase in complex with…
1IRS Irs-1 ptb domain complexed with a il-4 receptor phosphopeptide, NMR, minimized average…

Browse structure collections

About this viewer

MolViewer shows 5U1M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.