5USO: Schizosaccharomyces pombe Pot1pC

Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssRNA/ssDNA chimera (GGTTACrGrGrU). Determined by X-ray diffraction at 2.0 Å resolution. Released 18 Apr 2018.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Schizosaccharomyces pombe
Chains: 2
Atoms: 1,495
Mol. weight: 19.54 kDa
Released: 18 Apr 2018

Explore 5USO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5USO contains 4 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
β-strand	16-28	13	2
β-strand	33-38	6	2
β-strand	49	1	3
β-strand	63	1	3
β-strand	67-71	5	2
α-helix	73-79	7
β-strand	88-98	11	2
β-strand	104-108	5	2
β-strand	119-123	5	2
α-helix	128-130	3
α-helix	131-137	7
α-helix	138-140	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protection of telomeres protein 1	A	protein	139	Schizosaccharomyces pombe	O13988 (AlphaFold model)
7-9R_9mer dna/rna (5'-d(gpgptptpapc)-r(pgpgp*u)-3')	B	NA-hybrid	9	Schizosaccharomyces pombe

Sequence of entity 1 (A), FASTA

>5USO_1 Protection of telomeres protein 1 (chains A)
DSFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPF
GRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEK
VDSEEPELNEIKSRKRLYV

Sequence of entity 2 (B), FASTA

>5USO_2 7-9R_9mer DNA/RNA (5'-D(*GP*GP*TP*TP*AP*C)-R(P*GP*GP*U)-3') (chains B)
GGTTACGGU

Primary citation

Discrimination against RNA Backbones by a ssDNA Binding Protein. Lloyd, N.R., Wuttke, D.S. Structure (2018) 26:722-733.e2. DOI 10.1016/j.str.2018.03.016 · PubMed

Other PDB entries of the same protein (UniProt O13988 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5USB 1.61 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssRNA/ssDNA chimera…
4HIK 1.64 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTACGGT)
4HIM 1.75 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGATACGGT)
4HIO 1.75 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTAACGGT)
4HJ7 1.78 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTAGGGT)
4HID 1.82 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GCTTACGGT)
4HJ9 1.85 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (CGGTTACGGT)
1QZG 1.9 Å, Crystal structure of Pot1 (protection of telomere)- ssDNA complex
5USN 1.9 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssRNA/ssDNA chimera…
4HJ5 2.04 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTTCGGT)
4HJ8 2.04 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (GGTTACGCT)
4HJA 2.1 Å, Crystal Structure of Schizosaccharomyces pombe Pot1pC bound to ssDNA (ACGGTTACGGT)

Browse structure collections

About this viewer

MolViewer shows 5USO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.