5VR3: BRS domain of BRAF

Crystal structure of the BRS domain of BRAF. Determined by X-ray diffraction at 2.1 Å resolution. Released 14 Feb 2018.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 510
Mol. weight: 9.64 kDa
Released: 14 Feb 2018

Explore 5VR3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5VR3 contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	45-65	21
α-helix	76-99	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Braf	A	protein	88	Homo sapiens	P15056 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5VR3_1 BRAF (chains A)
GAMDPGGGGSSAADPAIPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYT
SKLDALQQREQQLLESLGNGTDFSVSSS

Primary citation

MEK drives BRAF activation through allosteric control of KSR proteins. Lavoie, H., Sahmi, M., Maisonneuve, P. et al. Nature (2018) 554:549-553. DOI 10.1038/nature25478 · PubMed

Other PDB entries of the same protein (UniProt P15056 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8VSO 1.5 Å, Ternary structure of 14-3-3 sigma, BRAF phosphopeptide (pS365) and compound 78 (1124378)
8JNB 1.62 Å, CRAF ras-binding domain chimera, ligand complex
8C7X 1.65 Å, Crystal structure of BRAF in complex with a hybrid compound 6
8C7Y 1.65 Å, Crystal structure of BRAF V600E in complex with a hybrid compound 6
9EW6 1.65 Å, Binary structure of 14-3-3s and BRAF phosphopeptide (pS365)
8JNA 1.7 Å, CRAF ras-binding domain chimera, apo form
9BP8 1.73 Å, Crystal structure of BRAF kinase domain with PF-07799933
5VYK 1.75 Å, Crystal structure of the BRS domain of BRAF in complex with the CC-SAM domain of KSR1
9BFB 1.92 Å, Crystal structure of BRAF kinase domain with PF-07284890
7K0V 1.93 Å, Crystal structure of bRaf in complex with inhibitor GNE-0749
5ITA 1.95 Å, Crystal Structure of BRAF Kinase Domain Bound to AZ-VEM
3NY5 1.99 Å, Crystal structure of the RBD domain of serine/threonine-protein kinase B-raf from Homo…

Browse structure collections

About this viewer

MolViewer shows 5VR3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.