Crystal structure of human Scribble PDZ1 domain. Determined by X-ray diffraction at 1.91 Å resolution. Released 8 Nov 2017.
Explore 5VWC in 3D Show helices and sheets RCSB PDB PDBe
5VWC contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 726-732 | 7 | 1 |
| β-strand | 740-744 | 5 | 1 |
| α-helix | 749-750 | 2 | |
| β-strand | 758-763 | 6 | 1 |
| α-helix | 768-772 | 5 | |
| α-helix | 778 | 1 | |
| β-strand | 779-783 | 5 | 1 |
| β-strand | 786-787 | 2 | 1 |
| α-helix | 793-801 | 9 | |
| β-strand | 806-812 | 7 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein scribble homolog | A | protein | 101 | Homo sapiens | Q14160 (AlphaFold model) |
>5VWC_1 Protein scribble homolog (chains A) GPLGSMEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGD KLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRERETSV
Structural basis for the differential interaction of Scribble PDZ domains with the guanine nucleotide exchange factor beta-PIX. Lim, K.Y.B., Godde, N.J., Humbert, P.O. et al. J Biol Chem (2017) 292:20425-20436. DOI 10.1074/jbc.M117.799452 · PubMed
Other PDB entries of the same protein (UniProt Q14160 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5VWC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.