5VWK: Human Scribble PDZ1:Beta-PIX complex
Crystal structure of human Scribble PDZ1:Beta-PIX complex. Determined by X-ray diffraction at 2.35 Å resolution. Released 8 Nov 2017.
- Method
- X-ray diffraction
- Resolution
- 2.35 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 3,594
- Mol. weight
- 56.1 kDa
- Released
- 8 Nov 2017
Explore 5VWK in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5VWK contains 19 α-helices and 52 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A and D: 4 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 716-720 | 5 | |
| β-strand | 724-732 | 9 | 1 |
| β-strand | 734 | 1 | 2 |
| β-strand | 737 | 1 | 2 |
| β-strand | 740-744 | 5 | 1 |
| β-strand | 746 | 1 | 3 |
| β-strand | 752 | 1 | 4 |
| β-strand | 755 | 1 | 4 |
| β-strand | 758-763 | 6 | 1 |
| α-helix | 768-771 | 4 | |
| α-helix | 778 | 1 | |
| β-strand | 779-783 | 5 | 1 |
| β-strand | 786-787 | 2 | 1 |
| β-strand | 792 | 1 | 3 |
| α-helix | 793-801 | 9 | |
| β-strand | 806-814 | 9 | 1 |
Chain B: 4 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 716-720 | 5 | |
| β-strand | 725-732 | 8 | 5 |
| β-strand | 734 | 1 | 6 |
| β-strand | 737 | 1 | 6 |
| β-strand | 740-744 | 5 | 5 |
| β-strand | 746 | 1 | 7 |
| β-strand | 752 | 1 | 8 |
| β-strand | 755 | 1 | 8 |
| β-strand | 758-763 | 6 | 5 |
| α-helix | 768-772 | 5 | |
| α-helix | 778 | 1 | |
| β-strand | 779-783 | 5 | 5 |
| β-strand | 786-787 | 2 | 5 |
| β-strand | 792 | 1 | 7 |
| α-helix | 793-801 | 9 | |
| β-strand | 806-813 | 8 | 5 |
Chain C: 5 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 716-720 | 5 | |
| β-strand | 724-732 | 9 | 9 |
| β-strand | 734 | 1 | 10 |
| β-strand | 737 | 1 | 10 |
| β-strand | 740-744 | 5 | 9 |
| β-strand | 748 | 1 | 11 |
| α-helix | 749-750 | 2 | |
| β-strand | 752 | 1 | 12 |
| β-strand | 755 | 1 | 12 |
| β-strand | 758-763 | 6 | 9 |
| α-helix | 768-771 | 4 | |
| α-helix | 778 | 1 | |
| β-strand | 779-783 | 5 | 9 |
| β-strand | 786-787 | 2 | 9 |
| α-helix | 793-801 | 9 | |
| β-strand | 806-814 | 9 | 9 |
Chain E: 0 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 160-162 | 3 | 13 |
Chain F: 0 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 157 | 1 | 11 |
| β-strand | 160-162 | 3 | 9 |
Chains G and H: 1 helix, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 157-159 | 3 | |
| β-strand | 160-162 | 3 | 5 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Protein scribble homolog | A, B, C, D | protein | 122 | Homo sapiens | Q14160 (AlphaFold model) |
| Beta-PIX | E, F, G, H | protein | 8 | Homo sapiens | |
Sequence of entity 1 (A, B, C, D), FASTA
>5VWK_1 Protein scribble homolog (chains A, B, C, D)
GPLGSSAPSVKGVSFDQANNLLIEPARIEEEELTLTILRQTGGLGISIAGGKGSTPYKGD
DEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRE
RM
Sequence of entity 2 (E, F, G, H), FASTA
>5VWK_2 Beta-PIX (chains E, F, G, H)
PAWDETNL
Primary citation
Structural basis for the differential interaction of Scribble PDZ domains with the guanine nucleotide exchange factor beta-PIX. Lim, K.Y.B., Godde, N.J., Humbert, P.O. et al. J Biol Chem (2017) 292:20425-20436. DOI 10.1074/jbc.M117.799452 · PubMed
Other PDB entries of the same protein (UniProt Q14160 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6MYE 1.1 Å, Crystal structure of human Scribble PDZ1 domain in complex with internal PDZ binding…
- 6EEY 1.15 Å, Crystal structure of human Scribble PDZ4 R1110G Mutant
- 2W4F 1.3 Å, Crystal structure of the first PDZ domain of human SCRIB1
- 6MS1 1.35 Å, Crystal structure of the human Scribble PDZ1 domain bound to the PDZ-binding motif of APC
- 6MYF 1.6 Å, Crystal structure of free human Scribble PDZ1 domain
- 5VWI 1.75 Å, Crystal structure of human Scribble PDZ1:Beta-PIX complex
- 7QRS 1.77 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
- 7QS9 1.8 Å, Structural basis on the interaction of Scribble PDZ domains with the Tick Born…
- 7QSB 1.84 Å, Structural basis on the interaction of Scribble PDZ domains with the Tick Born…
- 7QS8 1.85 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
- 7QRT 1.9 Å, Structural insight into the Scribble PDZ domains interaction with the oncogenic Human…
- 7QTP 1.9 Å, Structural biology of the NS1 avian influenza protein subversion on the Scribble cell…
Browse structure collections
About this viewer
MolViewer shows 5VWK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.