5W3E: Rhinovirus B14
CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar ratio 1:3, full particle). Determined by electron microscopy at 2.53 Å resolution. Released 12 Jul 2017.
- Method
- Electron microscopy
- Resolution
- 2.53 Å
- Organisms
- Mus musculus, Human rhinovirus 14
- Chains
- 6
- Atoms
- 8,107
- Mol. weight
- 117.37 kDa
- Released
- 12 Jul 2017
Explore 5W3E in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5W3E contains 42 α-helices and 78 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 12 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 18-20 | 3 | 6 |
| β-strand | 34-35 | 2 | 7 |
| α-helix | 37-39 | 3 | |
| α-helix | 47-49 | 3 | |
| β-strand | 56-57 | 2 | 6 |
| β-strand | 66 | 1 | 8 |
| α-helix | 67-70 | 4 | |
| β-strand | 75-84 | 10 | 9 |
| β-strand | 99-103 | 5 | 10 |
| α-helix | 110-116 | 7 | |
| β-strand | 119-133 | 15 | 9 |
| β-strand | 147-153 | 7 | 10 |
| β-strand | 155 | 1 | 11 |
| β-strand | 157 | 1 | 11 |
| α-helix | 158-160 | 3 | |
| α-helix | 166-169 | 4 | |
| β-strand | 175-179 | 5 | 10 |
| β-strand | 183-188 | 6 | 9 |
| β-strand | 197-198 | 2 | 9 |
| β-strand | 203 | 1 | 12 |
| α-helix | 212 | 1 | |
| α-helix | 217-219 | 3 | |
| β-strand | 223-228 | 6 | 10 |
| β-strand | 237-255 | 19 | 9 |
| α-helix | 257-259 | 3 | |
| α-helix | 262-263 | 2 | |
| α-helix | 275-277 | 3 | |
| α-helix | 280-282 | 3 | |
Chain B: 7 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-7 | 2 | |
| β-strand | 23 | 1 | 9 |
| α-helix | 30-35 | 6 | |
| β-strand | 39-40 | 2 | 9 |
| β-strand | 42 | 1 | 8 |
| α-helix | 43-46 | 4 | |
| β-strand | 51-52 | 2 | 7 |
| α-helix | 64-67 | 4 | |
| β-strand | 68-71 | 4 | 7 |
| β-strand | 79-84 | 6 | 13 |
| α-helix | 90-92 | 3 | |
| α-helix | 96-101 | 6 | |
| β-strand | 104-108 | 5 | 14 |
| β-strand | 111-117 | 7 | 7 |
| β-strand | 124-132 | 9 | 13 |
| β-strand | 134 | 1 | 15 |
| β-strand | 136 | 1 | 15 |
| β-strand | 149-154 | 6 | 13 |
| β-strand | 160-165 | 6 | 7 |
| β-strand | 174-175 | 2 | 14 |
| β-strand | 186-196 | 11 | 13 |
| α-helix | 197-198 | 2 | |
| β-strand | 205-213 | 9 | 7 |
| β-strand | 218-222 | 5 | 14 |
Chain C: 17 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 14-18 | 5 | 16 |
| β-strand | 21-25 | 5 | 16 |
| α-helix | 30-31 | 2 | |
| β-strand | 32-33 | 2 | 17 |
| α-helix | 34-36 | 3 | |
| α-helix | 41-43 | 3 | |
| α-helix | 52-53 | 2 | |
| β-strand | 54 | 1 | 17 |
| α-helix | 57-60 | 4 | |
| β-strand | 64-65 | 2 | 17 |
| α-helix | 67-68 | 2 | |
| β-strand | 69-71 | 3 | 18 |
| β-strand | 78-82 | 5 | 19 |
| α-helix | 84-86 | 3 | |
| α-helix | 90-98 | 9 | |
| β-strand | 99-111 | 13 | 17 |
| β-strand | 119-128 | 10 | 19 |
| α-helix | 131-133 | 3 | |
| β-strand | 134 | 1 | 20 |
| α-helix | 140-143 | 4 | |
| α-helix | 144-147 | 4 | |
| α-helix | 150-152 | 3 | |
| β-strand | 154-155 | 2 | 19 |
| α-helix | 159-160 | 2 | |
| β-strand | 165 | 1 | 20 |
| α-helix | 169-171 | 3 | |
| α-helix | 178-183 | 6 | |
| β-strand | 186-190 | 5 | 19 |
| β-strand | 196-201 | 6 | 17 |
| β-strand | 210 | 1 | 17 |
| β-strand | 215 | 1 | 12 |
| β-strand | 218-229 | 12 | 19 |
| α-helix | 230-231 | 2 | |
| β-strand | 238-240 | 3 | 18 |
| β-strand | 241-254 | 14 | 17 |
| α-helix | 257-261 | 5 | |
Chain D: 3 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 35-37 | 3 | |
| α-helix | 50-53 | 4 | |
| β-strand | 56 | 1 | 17 |
| α-helix | 59-61 | 3 | |
| β-strand | 62 | 1 | 21 |
| β-strand | 64 | 1 | 21 |
Chain E: 2 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-7 | 5 | 1 |
| β-strand | 11-12 | 2 | 2 |
| β-strand | 20-25 | 6 | 1 |
| β-strand | 34-39 | 6 | 3 |
| β-strand | 46-51 | 6 | 3 |
| β-strand | 57-59 | 3 | 3 |
| α-helix | 61-63 | 3 | |
| β-strand | 67-72 | 6 | 1 |
| β-strand | 77-82 | 6 | 1 |
| α-helix | 87-89 | 3 | |
| β-strand | 91-99 | 9 | 3 |
| β-strand | 102-104 | 3 | 3 |
| β-strand | 110-112 | 3 | 3 |
| β-strand | 113-114 | 2 | 2 |
Chain G: 1 helix, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-7 | 4 | 4 |
| β-strand | 10-12 | 3 | 5 |
| β-strand | 19-25 | 7 | 4 |
| β-strand | 33-38 | 6 | 5 |
| β-strand | 45-49 | 5 | 5 |
| β-strand | 53-54 | 2 | 5 |
| β-strand | 62-67 | 6 | 4 |
| β-strand | 70-75 | 6 | 4 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 5 |
| β-strand | 98 | 1 | 5 |
| β-strand | 102-105 | 4 | 5 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| C5 antibody variable heavy domain | E | protein | 116 | Mus musculus | |
| C5 antibody variable light domain | G | protein | 107 | Mus musculus | |
| viral protein 1 | A | protein | 289 | Human rhinovirus 14 | P03303 (AlphaFold model) |
| viral protein 3 | B | protein | 236 | Human rhinovirus 14 | P03303 (AlphaFold model) |
| viral protein 2 | C | protein | 262 | Human rhinovirus 14 | P03303 (AlphaFold model) |
| viral protein 4 | D | protein | 68 | Human rhinovirus 14 | P03303 (AlphaFold model) |
Sequence of entity 1 (E), FASTA
>5W3E_1 C5 antibody variable heavy domain (chains E)
AVQLAESGPALVAPSQALSITCTVAGFSLTAYGVAWVRQPPGAGLEWLGAIWAAGATDYN
AALKSRASIAKDNSKSQVFLAMASLATADTAAYYCAREWDAYGDYWGQGTTVTVSA
Sequence of entity 2 (G), FASTA
>5W3E_2 C5 antibody variable light domain (chains G)
DIVLTQSPAALSAAAGATVAATCRASGNIHNALAWYQQKAGKSPQLLVYAAAALAAGVPS
RFSGSGSGTAYALAINSLAADDFGAYYCQHFWSTPYTFGGGTKLEIK
Sequence of entity 3 (A), FASTA
>5W3E_3 viral protein 1 (chains A)
GLGDELEEVIVEKTKQTVASISSGPKHTQKVPILTANETGATMPVLPSDSIETRTTYMHF
NGSETDVECFLGRAACVHVTEIQNKDATGIDNHREAKLFNDWKINLSSLVQLRKKLELFT
YVRFDSEYTILATASQPDSANYSSNLVVQAMYVPPGAPNPKEWDDYTWQSASNPSVFFKV
GDTSRFSVPYVGLASAYNCFYDGYSHDDAETQYGITVLNHMGSMAFRIVNEHDEHKTLVK
IRVYHRAKHVEAWIPRAPRALPYTSIGRTNYPKNTEPVIKKRKGDIKSY
Sequence of entity 4 (B), FASTA
>5W3E_4 viral protein 3 (chains B)
GLPTTTLPGSGQFLTTDDRQSPSALPNYEPTPRIHIPGKVHNLLEIIQVDTLIPMNNTHT
KDEVNSYLIPLNANRQNEQVFGTNLFIGDGVFKTTLLGEIVQYYTHWSGSLRFSLMYTGP
ALSSAKLILAYTPPGARGPQDRREAMLGTHVVWDIGLQSTIVMTIPWTSGVQFRYTDPDT
YTSAGFLSCWYQTSLILPPETTGQVYLLSFISACPDFKLRLMKDTQTISQTVALTE
Sequence of entity 5 (C), FASTA
>5W3E_5 viral protein 2 (chains C)
SPNVEACGYSDRVQQITLGNSTITTQEAANAVVCYAEWPEYLPDVDASDVNKTSKPDTSV
CRFYTLDSKTWTTGSKGWCWKLPDALKDMGVFGQNMFFHSLGRSGYTVHVQCNATKFHSG
CLLVVVIPEHQLASHEGGNVSVKYTFTHPGERGIDLSSANEVGGPVKDVIYNMNGTLLGN
LLIFPHQFINLRTNNTATIVIPYINSVPIDSMTRHNNVSLMVIPIAPLTVPTGATPSLPI
TVTIAPMCTEFSGIRSKSIVPQ
Sequence of entity 6 (D), FASTA
>5W3E_6 viral protein 4 (chains D)
GAQVSTQKSGSHENQNILTNGSNQTFTVINYYKDAASTSSAGQSLSMDPSKFTEPVKDLM
LKGAPALN
Primary citation
Antibody-induced uncoating of human rhinovirus B14. Dong, Y., Liu, Y., Jiang, W. et al. Proc Natl Acad Sci U S A (2017) 114:8017-8022. DOI 10.1073/pnas.1707369114 · PubMed
Other PDB entries of the same protein (UniProt P03303 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6KYZ 1.84 Å, HRV14 3C in complex with single chain antibody YDF
- 9LGP 2.11 Å, Crystal structure of the HRV B14 3C protease in complex with AG7404
- 5W3M 2.26 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar…
- 6KZ0 2.4 Å, HRV14 3C in complex with single chain antibody GGVV
- 7BG7 2.4 Å, HRV14 in complex with its receptor ICAM-1
- 1NCQ 2.5 Å, The structure of HRV14 when complexed with pleconaril, an antiviral compound
- 7BG6 2.6 Å, HRV14 native particle solved by cryoEM
- 31LE 2.64 Å, HRV E1007A mutant
- 1K5M 2.7 Å, Crystal Structure of a Human Rhinovirus Type 14:Human Immunodeficiency Virus Type 1 V3…
- 31LF 2.71 Å, HRV virion E2250A mutant
- 5W3L 2.71 Å, CryoEM structure of rhinovirus B14 in complex with C5 Fab (4 degrees Celsius, molar…
- 29UB 2.73 Å, HRV B14 virion
Browse structure collections
About this viewer
MolViewer shows 5W3E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.