5WQD: TRF2 TRFH

Crystal structure of TRF2 TRFH in complex with an NBS1 peptide. Determined by X-ray diffraction at 3.0 Å resolution. Released 8 Mar 2017.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 14
Atoms: 11,619
Mol. weight: 179.21 kDa
Released: 8 Mar 2017

Explore 5WQD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5WQD contains 82 α-helices and 14 β-strands across 13 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	45-69	25
α-helix	73-87	15
α-helix	95-111	17
β-strand	118-119	2	1
α-helix	128-142	15
α-helix	147-167	21
α-helix	171-180	10
α-helix	186-201	16
α-helix	207-210	4
α-helix	214-227	14
α-helix	232-234	3
α-helix	235-243	9

Chain B: 12 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	46-69	24
α-helix	73-87	15
α-helix	96-111	16
β-strand	118-119	2	2
α-helix	128-142	15
α-helix	147-167	21
α-helix	171-181	11
α-helix	186-188	3
α-helix	189-201	13
α-helix	207-210	4
α-helix	214-227	14
α-helix	232-234	3
α-helix	235-242	8

Chain C: 10 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	44-69	26
α-helix	73-86	14
α-helix	95-111	17
β-strand	118-119	2	3
α-helix	128-143	16
α-helix	147-167	21
α-helix	171-181	11
α-helix	186-201	16
α-helix	207-210	4
α-helix	214-226	13
α-helix	235-243	9

Chain D: 12 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	44-69	26
α-helix	73-84	12
α-helix	96-111	16
β-strand	118-119	2	4
β-strand	121	1	5
β-strand	126	1	5
α-helix	128-142	15
α-helix	147-167	21
α-helix	171-182	12
α-helix	186-201	16
α-helix	207-210	4
α-helix	214-225	12
α-helix	226-228	3
α-helix	232-234	3
α-helix	235-243	9

Chain E: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	49-69	21
α-helix	73-87	15
α-helix	95-111	17
α-helix	122-124	3
α-helix	128-142	15
α-helix	147-167	21
α-helix	171-181	11
α-helix	189-201	13
α-helix	207-210	4
α-helix	214-226	13
α-helix	232-234	3
α-helix	236-242	7

Chain F: 13 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	45-69	25
α-helix	73-86	14
α-helix	95-111	17
α-helix	112-114	3
β-strand	119	1	6
α-helix	128-142	15
α-helix	147-167	21
α-helix	171-175	5
α-helix	192-201	10
α-helix	207-210	4
α-helix	214-225	12
α-helix	226-228	3
α-helix	232-234	3
α-helix	235-242	8

Chain G: 12 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	50-69	20
α-helix	73-86	14
α-helix	96-111	16
β-strand	119	1	7
α-helix	128-142	15
α-helix	147-150	4
α-helix	154-167	14
α-helix	171-180	10
α-helix	188-201	14
α-helix	207-210	4
α-helix	214-227	14
α-helix	232-234	3
α-helix	237-239	3

Chains H, I, J and K: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	434-435	2	1

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Telomeric repeat-binding factor 2	A, B, C, D, E, F, G	protein	204	Homo sapiens	Q15554 (AlphaFold model)
Nibrin	H, I, J, K, L, M, N	protein	16	Homo sapiens	O60934 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G), FASTA

>5WQD_1 Telomeric repeat-binding factor 2 (chains A, B, C, D, E, F, G)
GAGEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLGKEHTVSRLL
RVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTEFTLTEAVVESSRKLVKEAA
VIICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNIIREKNLAHPVIQNFSYETFQQKM
LRFLESHLDDAEPYLLTMAKKALK

Sequence of entity 2 (H, I, J, K, L, M, N), FASTA

>5WQD_2 Nibrin (chains H, I, J, K, L, M, N)
KMRIPNYQLSPTKLPS

Primary citation

NBS1 Phosphorylation Status Dictates Repair Choice of Dysfunctional Telomeres. Rai, R., Hu, C., Broton, C. et al. Mol Cell (2017) 65:801-817.e4. DOI 10.1016/j.molcel.2017.01.016 · PubMed

Other PDB entries of the same protein (UniProt Q15554 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3SJM 1.35 Å, Crystal Structure Analysis of TRF2-Dbd-DNA complex
1W0U 1.8 Å, hTRF2 DNA-binding domain in complex with telomeric DNA.
3K6G 1.95 Å, Crystal structure of Rap1 and TRF2 complex
4M7C 2.05 Å, Crystal structure of the TRF2-binding motif of SLX4 in complex with the TRFH domain of…
6J67 2.05 Å, Crystal structure of the compound 34 in a complex with TRF2
3BU8 2.15 Å, Crystal Structure of TRF2 TRFH domain and TIN2 peptide complex
7C5D 2.15 Å, Crystal structure of TRF2 TRFH domain in complex with a MCPH1 peptide
1H6P 2.2 Å, Dimeristion domain from human TRF2
5XYF 2.2 Å, Crystal structure of the human TIN2-TPP1-TRF2 telomeric complex
4RQI 2.44 Å, Structure of TRF2/RAP1 secondary interaction binding site
3BUA 2.5 Å, Crystal Structure of TRF2 TRFH domain and APOLLO peptide complex
9Q9K 2.59 Å, Cryo-EM structure of human Mre11-Rad50 (MR) complex bound to DNA and telomeric factor…

Browse structure collections

About this viewer

MolViewer shows 5WQD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.