5WYN: HtrA2 Pathogenic Mutant

HtrA2 Pathogenic Mutant. Determined by X-ray diffraction at 2.05 Å resolution. Released 8 Aug 2018.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,421
Mol. weight: 36.42 kDa
Released: 8 Aug 2018

Explore 5WYN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5WYN contains 12 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	10-12	3
α-helix	16-24	9
α-helix	25-27	3
β-strand	28-37	10	1
β-strand	42-55	14	1
β-strand	59-62	4	1
α-helix	64-67	4
β-strand	72-76	5	1
β-strand	82-91	10	1
β-strand	96-100	5	1
α-helix	106-108	3
β-strand	112	1	2
α-helix	115-117	3
α-helix	118-119	2
β-strand	123-126	4	2
β-strand	138-142	5	2
α-helix	161	1
β-strand	162-164	3	2
β-strand	176-179	4	2
β-strand	184-193	10	2
β-strand	196-201	6	2
α-helix	202-209	8
β-strand	227-228	2	3
β-strand	231-235	5	4
α-helix	238-247	10
β-strand	258-263	6	4
α-helix	268-272	5
β-strand	279-283	5	4
β-strand	286-287	2	4
α-helix	291-300	10
β-strand	304-310	7	4
β-strand	313-319	7	4
β-strand	322-323	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine protease HTRA2, mitochondrial	A	protein	332	Homo sapiens	O43464 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5WYN_1 Serine protease HTRA2, mitochondrial (chains A)
MAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGL
IVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVR
QGEFVVAMGSPFALQNTITSGIVCSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVN
LDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPS
ILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVWEAVR
TQSQLAVQIRRGRETLTLYVTPEVTEHHHHHH

Primary citation

Structural basis of inactivation of human counterpart of mouse motor neuron degeneration 2 mutant in serine protease HtrA2. Wagh, A.R., Bose, K. Biosci Rep (2018) 38. DOI 10.1042/BSR20181072 · PubMed

Other PDB entries of the same protein (UniProt O43464 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M3N 1.65 Å, HTRA2 wild-type structure
5TO1 1.69 Å, HtrA2 exposed (L266R, F303A) mutant
5M3O 1.7 Å, HTRA2 A141S mutant structure
5TNY 1.7 Å, HTRA2 G399S mutant
5TNZ 1.75 Å, HtrA2 S142D mutant
5TO0 1.9 Å, HTRA2 S276C mutant
5FHT 1.95 Å, HtrA2 protease mutant V226K
1LCY 2.0 Å, Crystal Structure of the Mitochondrial Serine Protease HtrA2
2PZD 2.75 Å, Crystal Structure of the HtrA2/Omi PDZ Domain Bound to a Phage-Derived Ligand (WTMFWV)
8E2K 3.21 Å, Cryo-EM structure of BIRC6/HtrA2-S306A
7VGE 4.0 Å, Structure of the PDZ deleted variant of HtrA2 protease (S306A)
8AUK 6.2 Å, Cryo-EM structure of human BIRC6 in complex with HTRA2.

Browse structure collections

About this viewer

MolViewer shows 5WYN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.