5XBY: PKA-Protein A fusion protein

Crystal structure of the PKA-Protein A fusion protein (end-to-end fusion). Determined by X-ray diffraction at 3.25 Å resolution. Released 5 Jul 2017.

Method: X-ray diffraction
Resolution: 3.25 Å
Organisms: Homo sapiens, Staphylococcus aureus
Chains: 4
Atoms: 2,553
Mol. weight: 44.52 kDa
Released: 5 Jul 2017

Explore 5XBY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XBY contains 18 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	9-23	15
α-helix	28-41	14

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	5-6	2
α-helix	9-23	15
α-helix	28-55	28
α-helix	62-74	13
α-helix	76-78	3
α-helix	79-92	14

Chain C: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	9-23	15
α-helix	28-51	24
α-helix	54-56	3
α-helix	62-74	13
α-helix	80-92	13

Chain D: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	9-23	15
α-helix	28-56	29
α-helix	62-74	13
α-helix	76-78	3
α-helix	79-92	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cAMP-dependent protein kinase type II-alpha regulatory subunit,Immunoglobulin G-binding protein A	A, B, C, D	protein	97	Homo sapiens, Staphylococcus aureus	P13861 (AlphaFold model), P38507 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5XBY_1 cAMP-dependent protein kinase type II-alpha regulatory subunit,Immunoglobulin G-binding protein A (chains A, B, C, D)
GSPWQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARNKEQQNAFYEILHLPN
LNEEQRNAFIQSLKDDPSQSANLLAEAKKLNDAQAPK

Primary citation

Construction of novel repeat proteins with rigid and predictable structures using a shared helix method. Youn, S.J., Kwon, N.Y., Lee, J.H. et al. Sci Rep (2017) 7:2595-2595. DOI 10.1038/s41598-017-02803-z · PubMed

Other PDB entries of the same protein (UniProt P13861 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2IZX 1.3 Å, Molecular Basis of AKAP Specificity for PKA Regulatory Subunits
5H78 2.0 Å, Crystal structure of the PKA-DHR14 fusion protein
9NXN 2.1 Å, Crystal structure of CN:RII alpha
4ZP3 2.63 Å, AKAP18:PKA-RIIalpha structure reveals crucial anchor points for recognition of…
5H77 3.2 Å, Crystal structure of the PKA-protein A fusion protein
2KYG Structure of the AML1-ETO Nervy Domain - PKA(RIIa) complex and its contribution to…
8S8O Solution Structure of cAMP-dependent Protein Kinase RII-alpha Subunit Dimerization and…

Browse structure collections

About this viewer

MolViewer shows 5XBY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.