5XON: RNA Polymerase II elongation complex

RNA Polymerase II elongation complex bound with Spt4/5 and TFIIS. Determined by electron microscopy at 3.83 Å resolution. Released 16 Aug 2017.

Method: Electron microscopy
Resolution: 3.83 Å
Organisms: Komagataella phaffii (strain GS115 / ATCC 20864), synthetic construct
Chains: 18
Atoms: 38,369
Mol. weight: 652.14 kDa
Ligands: ZN, MG
Released: 16 Aug 2017

Explore 5XON in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XON contains 178 α-helices and 256 β-strands across 15 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 68 helices, 63 β-strands

Element	Residues	Length	Sheet
α-helix	5-6	2
α-helix	10	1
β-strand	11	1	1
β-strand	16-21	6	2
α-helix	22-23	2
α-helix	24-30	7
β-strand	34-35	2	3
β-strand	82-84	3	3
β-strand	90	1	4
α-helix	96-105	10
β-strand	106	1	5
β-strand	113	1	5
α-helix	120-125	6
α-helix	131-139	9
β-strand	147	1	6
β-strand	171	1	6
β-strand	174-178	5	7
β-strand	181-186	6	7
β-strand	199-202	4	7
α-helix	205-212	8
α-helix	217-222	6
β-strand	226	1	8
β-strand	230	1	8
α-helix	232-234	3
β-strand	237	1	4
β-strand	240-242	3	3
α-helix	262-280	19
α-helix	290-302	13
α-helix	313-315	3
β-strand	316	1	9
β-strand	322	1	9
α-helix	326-330	5
β-strand	345	1	10
β-strand	349-353	5	11
β-strand	356	1	12
β-strand	364-367	4	11
α-helix	369-374	6
β-strand	376-380	5	13
α-helix	386-394	9
β-strand	403-407	5	13
β-strand	413-415	3	13
α-helix	427-428	2
β-strand	432-436	5	13
α-helix	437	1
β-strand	442-446	5	11
α-helix	450	1
β-strand	456-463	8	11
β-strand	471	1	12
α-helix	473-475	3
β-strand	487-491	5	11
α-helix	496-505	10
α-helix	509-511	3
β-strand	513-514	2	14
β-strand	519-520	2	14
α-helix	527-535	9
β-strand	542	1	15
α-helix	544-552	9
α-helix	561-563	3
β-strand	566-568	3	16
β-strand	572	1	16
β-strand	573	1	15
α-helix	575-580	6
β-strand	588-591	4	17
β-strand	606-609	4	17
β-strand	612-615	4	17
α-helix	630-635	6
α-helix	640-659	20
α-helix	667-670	4
α-helix	674-699	26
α-helix	703-706	4
α-helix	711-737	27
α-helix	743-749	7
α-helix	756-763	8
β-strand	767	1	18
β-strand	771	1	19
β-strand	774	1	19
β-strand	780	1	20
β-strand	783	1	20
α-helix	795-797	3
β-strand	801	1	18
α-helix	811-845	35
β-strand	857-858	2	21
β-strand	864-866	3	21
α-helix	869-871	3
β-strand	879-883	5	22
α-helix	891-898	8
α-helix	911-913	3
β-strand	914	1	23
α-helix	924-943	20
α-helix	944-948	5
β-strand	955-959	5	22
α-helix	962-972	11
β-strand	981	1	23
α-helix	985-995	11
α-helix	1007-1016	10
α-helix	1019-1027	9
α-helix	1031-1034	4
α-helix	1042-1057	16
α-helix	1066-1075	10
α-helix	1077-1080	4
α-helix	1099-1107	9
β-strand	1117-1120	4	24
α-helix	1124-1127	4
α-helix	1130-1140	11
β-strand	1143-1144	2	25
α-helix	1145-1148	4
β-strand	1149-1155	7	26
α-helix	1169-1172	4
β-strand	1194-1199	6	26
α-helix	1201-1206	6
α-helix	1211-1221	11
β-strand	1226-1230	5	26
β-strand	1239-1244	6	26
α-helix	1261-1272	12
β-strand	1275-1277	3	25
β-strand	1284-1295	12	24
β-strand	1301-1312	12	24
α-helix	1316-1319	4
β-strand	1331	1	24
α-helix	1335-1342	8
α-helix	1345-1360	16
α-helix	1368-1378	11
α-helix	1390-1393	4
α-helix	1399-1403	5
α-helix	1409-1416	8
β-strand	1422	1	2
α-helix	1427-1431	5
α-helix	1440-1442	3
β-strand	1444-1448	5	27
α-helix	1453-1455	3
α-helix	1458-1460	3

Chain B: 44 helices, 79 β-strands

Element	Residues	Length	Sheet
α-helix	15-27	13
α-helix	32-40	9
α-helix	41-45	5
α-helix	46-51	6
β-strand	55-57	3	28
β-strand	60	1	29
β-strand	73	1	29
β-strand	74-78	5	28
β-strand	82-84	3	30
β-strand	88-90	3	31
β-strand	96-98	3	31
α-helix	101-106	6
β-strand	112-117	6	30
β-strand	120-124	5	28
β-strand	156-162	7	30
α-helix	177-182	6
β-strand	194-196	3	32
β-strand	199-203	5	32
α-helix	204	1
β-strand	205	1	33
β-strand	206-209	4	34
β-strand	215-218	4	35
β-strand	227-234	8	35
β-strand	241-249	9	35
β-strand	252	1	36
β-strand	255	1	36
β-strand	261-264	4	35
β-strand	273	1	35
α-helix	275-281	7
α-helix	287-293	7
α-helix	302-312	11
α-helix	319-327	9
α-helix	338-351	14
α-helix	364-382	19
α-helix	387-390	4
α-helix	394-396	3
β-strand	397-400	4	34
α-helix	403-430	28
α-helix	444-456	13
β-strand	473-475	3	32
α-helix	482-485	4
β-strand	490-491	2	33
α-helix	509-511	3
β-strand	512	1	37
β-strand	515	1	37
β-strand	530-531	2	33
β-strand	532	1	37
β-strand	537-538	2	38
α-helix	545-554	10
α-helix	556	1
β-strand	557-558	2	39
α-helix	570	1
β-strand	571-575	5	39
β-strand	578-583	6	39
α-helix	587-598	12
β-strand	607-611	5	39
β-strand	616-620	5	39
β-strand	626-632	7	38
β-strand	633	1	40
β-strand	637	1	41
β-strand	639	1	41
β-strand	645	1	40
α-helix	649-657	9
α-helix	678-683	6
β-strand	687-691	5	38
α-helix	692-695	4
β-strand	700-701	2	38
α-helix	704-707	4
β-strand	740-741	2	38
α-helix	745-748	4
α-helix	764-773	10
β-strand	794-796	3	42
β-strand	800	1	43
β-strand	804-805	2	44
α-helix	807-811	5
β-strand	821-827	7	45
β-strand	838-842	5	45
α-helix	843-848	6
β-strand	853-862	10	42
β-strand	874	1	46
β-strand	882-883	2	47
β-strand	898	1	48
α-helix	899-900	2
β-strand	904-905	2	42
β-strand	910-912	3	48
β-strand	914	1	46
β-strand	915-917	3	47
α-helix	918-919	2
β-strand	934-936	3	47
β-strand	939-940	2	48
α-helix	941-942	2
β-strand	947-956	10	42
β-strand	962-972	11	42
β-strand	979-981	3	45
β-strand	987-994	8	45
α-helix	996-998	3
β-strand	1002	1	49
β-strand	1010-1012	3	45
α-helix	1014-1016	3
α-helix	1023-1038	16
α-helix	1041	1
β-strand	1042-1043	2	44
α-helix	1053-1061	9
β-strand	1069-1070	2	50
β-strand	1072	1	49
β-strand	1073	1	51
β-strand	1080	1	51
β-strand	1085-1086	2	50
β-strand	1087-1094	8	45
α-helix	1099-1101	3
β-strand	1104-1105	2	11
α-helix	1117-1119	3
β-strand	1129	1	10
α-helix	1132-1141	10
α-helix	1144-1150	7
β-strand	1157-1163	7	1
β-strand	1172-1174	3	52
β-strand	1179-1181	3	52
β-strand	1182	1	53
β-strand	1187	1	53
β-strand	1191-1197	7	1
α-helix	1198-1209	12
β-strand	1212-1217	6	2

Chain C: 5 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	6-12	7	54
β-strand	16-22	7	54
α-helix	27-38	12
β-strand	42-53	12	55
α-helix	59-67	9
β-strand	71	1	56
β-strand	96-102	7	55
β-strand	111-114	4	57
β-strand	119-122	4	55
β-strand	132	1	56
α-helix	133	1
β-strand	143-147	5	57
β-strand	153-162	10	55
β-strand	176-180	5	54
α-helix	211-214	4
β-strand	228-233	6	54
α-helix	240-264	25

Chain D: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	24	1	58
β-strand	29	1	58
β-strand	37-39	3	59
β-strand	45-47	3	59
α-helix	53-71	19
α-helix	86-90	5
α-helix	97-110	14
α-helix	118-128	11
α-helix	139-145	7
α-helix	153-158	6
α-helix	161-163	3
α-helix	172-180	9

Chain E: 9 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	3-24	22
β-strand	27	1	60
α-helix	31-34	4
α-helix	38-45	8
β-strand	46	1	61
β-strand	52	1	61
α-helix	54-56	3
β-strand	59-61	3	62
β-strand	63	1	60
α-helix	65-70	6
β-strand	77-81	5	62
β-strand	86-87	2	63
α-helix	89-102	14
β-strand	106-111	6	62
β-strand	114-115	2	63
α-helix	117-120	4
β-strand	130-135	6	62
β-strand	151-154	4	64
α-helix	157-167	11
β-strand	176	1	64
α-helix	182-185	4
β-strand	194-201	8	64
β-strand	205-212	8	64

Chain F: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	84	1	65
α-helix	87-102	16
α-helix	117-127	11
β-strand	132-137	6	27
β-strand	143-147	5	27
β-strand	152	1	65

Chain G: 3 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	66
β-strand	5-13	9	67
α-helix	15-17	3
α-helix	22-33	12
β-strand	38-39	2	68
β-strand	43-44	2	68
β-strand	45-49	5	67
β-strand	59-61	3	27
β-strand	68-78	11	67
β-strand	79	1	66
β-strand	85-95	11	69
β-strand	98-103	6	69
β-strand	106-111	6	69
α-helix	112-114	3
β-strand	120-122	3	70
β-strand	129-132	4	70
β-strand	135-138	4	70
β-strand	142-152	11	69
β-strand	157-162	6	69
β-strand	170	1	69

Chain H: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	6-16	11	16
β-strand	23-30	8	16
β-strand	37-43	7	16
β-strand	55-60	6	16
α-helix	80-82	3
α-helix	89-91	3
β-strand	94-105	12	16
β-strand	111-118	8	16
β-strand	120-126	7	16
α-helix	128-131	4
β-strand	138-144	7	16

7 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit	A	protein	1743	Komagataella phaffii (strain GS115 / ATCC 20864)	C4R4Y0
DNA-directed RNA polymerase subunit beta	B	protein	1227	Komagataella phaffii (strain GS115 / ATCC 20864)	C4QZQ7 (AlphaFold model)
RNA polymerase II third largest subunit B44, part of central core	C	protein	304	Komagataella phaffii (strain GS115 / ATCC 20864)	C4R7L2 (AlphaFold model)
RNA polymerase II subunit B32	D	protein	186	Komagataella phaffii (strain GS115 / ATCC 20864)	C4R2U9 (AlphaFold model)
RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III	E	protein	214	Komagataella phaffii (strain GS115 / ATCC 20864)	C4R3P8
RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III	F	protein	155	Komagataella phaffii (strain GS115 / ATCC 20864)	C4R1V1
RNA polymerase II subunit	G	protein	171	Komagataella phaffii (strain GS115 / ATCC 20864)	C4R9A1
RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III	H	protein	145	Komagataella phaffii (strain GS115 / ATCC 20864)	C4R273
DNA-directed RNA polymerase subunit	I	protein	115	Komagataella phaffii (strain GS115 / ATCC 20864)	C4QY79
RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III	J	protein	72	Komagataella phaffii (strain GS115 / ATCC 20864)	C4R009
RNA polymerase II subunit B12.5	K	protein	118	Komagataella phaffii (strain GS115 / ATCC 20864)	C4R3Z5
RNA polymerase subunit, found in RNA polymerase complexes I, II, and III	L	protein	72	Komagataella phaffii (strain GS115 / ATCC 20864)	C4QWA8

6 more molecules are not listed.

Sequence of entity 1 (A), FASTA

>5XON_1 DNA-directed RNA polymerase subunit (chains A)
MSQFPYSSAPLRSVKEVQFGLLSPEEIRAISVVKIEYPEIMDESRQRPREGGLNDPKLGS
IDRNFKCQTCGEGMAECPGHFGHMELAKPVFHIGFIPKIKKVCECICMNCGKLLLDETNP
TMAQAIRIRDPKKRFNAVWQLCKTKMVCEADAPVDEYSEQKVVSRGGCGNTQPVVRKDGM
KLWGTWKKSGFSDRDAQPERKLLTPGEILNVFKHISPEDCFRLGFNEDYARPEWMIITVL
PVPPPQVRPSIAMDETTQGQDDLTHKLSDILKANINVQKLEMDGSPQHIINEVEQLLQFH
VATYMDNDIAGQPQALQKSGRPVKAIRARLKGKEGRLRGNLMGKRVDFSARTVISGDPNL
ELDQVGVPISIAKTLSYPETVTQYNIHRLTEYVRNGPNEHPGAKYVIRDNGDRIDLRYHK
RAGDIVLQYGWKVERHLMDDDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYN
ADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPVMGIVQDTLCGVRKMTLRDT
FIEYEQVMNMLFWVPSWDGVVPQPAILKPKPLWTGKQLLSIAIPSGIHLQRTDGGNSLLS
PKDNGMLIVDGKVMFGVVDKKTVGSGGGGLIHTVMREKGPKICAELFGNIQKVVNYWLLH
NGFSIGIGDAIADASTMKEITHAISSAKEQVQEIIYKAQHNELELKPGMTLRESFEGEVS
RTLNDARDSAGRSAEMNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQMVEGKRIAFGF
ADRSLPHFTKDDFSPESKGFVENSYLRGLTPQEFFFHAMAGREGLIDTAVKTAETGYIQR
RLVKALEDIMVHYDGTTRNSLGDIIQFLYGEDGLDGTQVERQTIDTIPGSDKAFHKRYYV
DLMDEKNSIKPDVIEYAADILGDVELQKELNSEYEQLVSDRKFLREIVFVNGDHNWPLPV
NLRRIIQNAQQIFHLDRAKASDLTIPEIIHGVRDLCKKLFVLRGENELIKEAQQNATSLF
QCLVRARLATRRILEEFRLNRDAFEWVLGTIEAQFQRSLVHPGEMVGVIAAQSIGEPATQ
MTLNTFHYAGVSSKNVTLGVPRLKEILNVAKNIKTPALTVYLDREIALDIEKAKVIQSSI
EYTTLKNVTSATEIYYDPDPTSTVIEEDFDTVEAYFSIPDEKVEETIDKQSPWLLRLELD
RARMLDKQLTMNQVADKISEVFSDDLFVMWSEDNADKLIIRCRVIRDPKAMDEELEAEED
QMLKRIEAHMLDLIALRGIPGISKVYMVKHKVSVPDESGEYKNEELWALETDGINLAEVM
AVPGVDSSRTYSNSFVEILSVLGIEATRSSLYKEILNVIAFDGSYVNYRHMALLVDVMTS
RGYLMAITRHGINRADTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVMLGQLAPMG
TGAFDVMIDEKLLTSLPADYAPTMPLFKGKATQGSATPYDNNAQYDDEFNHDDVADVMFS
PMAETGSGDDRSGGLTEYAGIQSPYQPTSPGLSATSPGFAPTSPGFAPTSPRYSPTSPGY
SPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS
PSYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYS
PTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPASPQYSPSRHSPNGESK
EGE

Sequence of entity 2 (B), FASTA

>5XON_2 DNA-directed RNA polymerase subunit beta (chains B)
MSYDPYSIDDTITTEDCWTVISAFFEEKGLVSQQLDSFDEFMETSIQDLVWEEPRLILDQ
PAQHTNEKDNINKRYEIRFGKIYLSRPTMTEADGTTHAMFPQEARLRNLTYSSPVYLDME
KSMFTSIDDEGNPNATLDWQQVHEPIKDGVEEGNKVHIGKVPIMLRSKFCSLRTLDEVDL
YKMKECPYDMGGYFVINGSEKVLIAQERSAANIVQVFKKAAPSPISHVAEIRSALEKGSR
LISTMQIKLYGREDKGTGRTIKATLPYVKQDIPIVIVFRALGVVPDGEILQHICYDENDW
QMLEMLKPCIEEGFVIQDKEVALDFIGRRGSAALGIRREKRIQYAKDILQKELLPHITQE
EGFETRKTFFLGYMVNRLLLCALERKDQDDRDHFGKKRLDLAGPLLANLFRILFRKLTRE
IYRYMQRCIETDRDFNLNLAVKSTTITSGLKYSLATGNWGEQKKAMSSRAGVSQVLNRYT
YSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLLSGISI
GSPSEPIINFLEEWGMEPLEDYDPAQHTKSTRIFVNGVWTGIHRDPSMLVSTMRDLRRSG
AISPEVSIIRDIREREFKIFTDVGRVYRPLFIVEDDESKDNKGELRITKEHIRKIQQGYD
DDAMNDDSEEQEQDVYGWSSLVTSGVIEYVDGEEEETIMIAMTPEDLQTRSLEQKEIDLN
DTAKRIKPEMSTSSHHTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGV
FLTNYNVRMDTMANILYYPQKPLAKTQAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMI
MNQSSIDRGLFRSLFFRSYMDQEKRFGISIVEEFEKPTRATTLRLKHGTYEKLDEDGLIA
PGVRVSGDDIIIGKTTPIPPDTEELGQRTKYHTKRDASTPLRSTENGIVDQVLLTTNQEG
LKFVKVRMRTTKVPQIGDKFASRHGQKGTIGVTYRHEDMPFSAEGIVPDLIINPHAIPSR
MTVAHLIECLLSKVGSIRGYEGDATPFTDLTVDAVSNLLRDNGYQSRGFEVMYNGHTGKK
LMAQVFFGPTYYQRLRHMVDDKIHARARGPVQVLTRQPVEGRSRDGGLRFGEMERDCMIA
HGAAGFLKERLMEASDAFRVHVCGICGLMSVIANLKKNQFECRSCKNKTNIYQLHIPYAA
KLLFQELMAMNIAPRLYTERSGVSMRS

Sequence of entity 3 (C), FASTA

>5XON_3 RNA polymerase II third largest subunit B44, part of central core (chains C)
MSKEPKVNIINAQDDEVELMLSDVNLSLANSLRRTMLAEVPTLAIDLVEIKMNTSVLADE
FISHRLGLIPLVSEDVEEMKYSRDCTCEDYCDECSVVLELSARHEGEEGTTDVYSSSLIK
VSGPGNLNVGEPVRRDDYDQGILLCKLRNHQELNIRCIAKKGIAKEHAKWSPCSAIAFEY
DPHNKLKHTDFWFEVDAKKEWPDSKYATWEEPPKPGEVFDYKAKPNRFYMTVETTGSLKA
NQVFSRGIKTLQEKLANVLFELENSRPANTTAYGGATAYGGQTVYGRETSYGGNTNYGDY
NAPY

Sequence of entity 4 (D), FASTA

>5XON_4 RNA polymerase II subunit B32 (chains D)
MNVSTSTVGARRRRAKQQVDDEENATLLRLGPEFALKQYDHDGNEHDLIALSLSESRLLI
REALKARSRARNGGVDIESSNGEIDDDELAKVTSGAVANGVVKKTLDYLNTFARFKDEET
CTAVDQLLHNSSDCSVLHPFEIAQLSSLGCEDVDEAITLIPSLAAKKEVNLQRILDELNR
LEDPYK

Sequence of entity 5 (E), FASTA

>5XON_5 RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III (chains E)
MEDNNRIISRLWRSFRTVKEMAADRGYFISQEEMDQSLEEFRSKICDSMGNPQRKLMSFL
ANPTPEALEKYSDLGTLWVEFCDEPSVGIKTMRNFCLRIQEKNFSTGIFIYQNNITPSAN
KMIPTVSPAIIETFQESDLVVNITHHELVPKHIRLSDGEKSQLLQRYKLKESQLPRIQRE
DPVARYLGLKRGQVVKIIRRSETSGRYASYRICL

Sequence of entity 6 (F), FASTA

>5XON_6 RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III (chains F)
MSEDEAFNEQTENFENFEDEHFSDDNFEDRSTQPEDYAVGVTADGRQIINGDGIQEVNGT
IKAHRKRSNKELAILKEERTTTPYLTKYERARILGTRALQISMNAPVLVDIEGETDPLQI
AMKELSQRKIPLVIRRYLPDGSYEDWGCDELIVDN

Sequence of entity 7 (G), FASTA

>5XON_7 RNA polymerase II subunit (chains G)
MFFLKDLSLILTLHPSYFGPQMNQYLREKLLTDVEGTCTGQFGYIVTVLDGMNIDVGKGR
IIPGSGSAEFEVKYRAVVWKPFKGEVVDAIVSNVSPIGFFADVGPLNVFVSTRLIPDNLV
YNPSNSPPAYMSNDELITKGSKVRLKVVGTRTDVNEIYAIGSIKEDFLGAI

Sequence of entity 8 (H), FASTA

>5XON_8 RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III (chains H)
MSSALFDDIFTVQTVDNGRYNKVSRIIGISTTNSAIKLTLDINNEMFPVSQDDSLTVTLA
NSLSLDGEDESANFSKSWRPPKPTDKSLADDYDYVMFGTVYKFEEGDEDKIKVYVSFGGL
LMCLEGGYKSLASLKQDNLYILIRR

Sequence of entity 9 (I), FASTA

>5XON_9 DNA-directed RNA polymerase subunit (chains I)
MASFRFCLECNNMLYPKEDKENQRLLYSCRNCDYTELAEDPKVYRHELITNIGETAGIVD
DIGQDPTLPRSDKECPECHSRDCVFFQSQQRRKDTNMTLFYVCLNCKKTFRDESE

Sequence of entity 10 (J), FASTA

>5XON_10 RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III (chains J)
MIIPVRCFSCGKVVGDKWDAYLRLLEEGKQEGDALDELKLKRYCCRRMVLTHVDLIEKFL
RYNPLEKKDFDS

Sequence of entity 11 (K), FASTA

>5XON_11 RNA polymerase II subunit B12.5 (chains K)
MNAPDRFELFILPDDVPKLKITPDSRVPNCIIIKFEREDHTLANLLREELALYPDVTFVA
YKVEHPLFANFVMRLQTEEGTRPKQALERACASIINKLKTLDHKFNEEWNIKNFSLND

Sequence of entity 12 (L), FASTA

>5XON_12 RNA polymerase subunit, found in RNA polymerase complexes I, II, and III (chains L)
MSREGFVAPSGTDLAAAASGVAPNKHYGVKYTCGACAHNFSLNKSDPVRCKECGHRVIYK
ARTKRMIQFDAR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	10
MG	Magnesium ion	Mg	1

Primary citation

Structure of the complete elongation complex of RNA polymerase II with basal factors. Ehara, H., Yokoyama, T., Shigematsu, H. et al. Science (2017) 357:921-924. DOI 10.1126/science.aan8552 · PubMed

Other PDB entries of the same protein (UniProt C4R4Y0), best resolution first:

5XOG 3.0 Å, RNA Polymerase II elongation complex bound with Spt5 KOW5 and Elf1
7XN7 3.1 Å, RNA polymerase II elongation complex containing Spt4/5, Elf1, Spt6, Spn1 and Paf1C
8JH4 3.2 Å, RNA polymerase II elongation complex containing 60 bp upstream DNA loop, stalled at…
8YFQ 3.3 Å, Cryo EM structure of Komagataella phaffii RNAPII-Rat1-Rai1 pre-termination complex
7XSZ 3.4 Å, RNA polymerase II elongation complex transcribing a nucleosome (EC115)
8YFR 3.4 Å, Cryo EM structure of Komagataella phaffii Rat1-Rai1 complex bound within the RNAPII cleft
9WMS 3.4 Å, Co-transcriptional histone H3K36 methylation complex containing RNA polymerase II…
9II7 3.5 Å, RNA polymerase II elongation complex stalled at SHL(-1) of the nucleosome containing…
9WMT 3.59 Å, Co-transcriptional histone H3K36 methylation complex containing RNA polymerase II…
7XSE 3.6 Å, RNA polymerase II elongation complex transcribing a nucleosome (EC42)
9UJS 3.62 Å, RNA polymerase II elongation complex stalled at SHL(-4) of the H3-H4 octasome
9WMW 3.62 Å, Co-transcriptional histone H3K36 methylation complex containing RNA polymerase II…

Browse structure collections

About this viewer

MolViewer shows 5XON directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.