5XPR: Human endothelin receptor type-B

Human endothelin receptor type-B in complex with antagonist bosentan. Determined by X-ray diffraction at 3.6 Å resolution. Released 16 Aug 2017.

Method: X-ray diffraction
Resolution: 3.6 Å
Organisms: Homo sapiens, Enterobacteria phage T4
Chains: 1
Atoms: 3,229
Mol. weight: 53.06 kDa
Ligands: K86
Released: 16 Aug 2017

Explore 5XPR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XPR contains 21 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	93-128	36
α-helix	130-134	5
α-helix	138-153	16
α-helix	154-158	5
α-helix	159-163	5
α-helix	171-201	31
α-helix	217-239	23
β-strand	240-246	7	1
β-strand	251-257	7	1
α-helix	264-271	8
α-helix	273-275	3
α-helix	276-283	8
α-helix	284-1010	29
α-helix	1025-1037	13
α-helix	1042-1047	6
α-helix	1050-1068	19
α-helix	1072-1079	8
α-helix	1083-1091	9
α-helix	1094-1098	5
α-helix	1100-1112	13
α-helix	313-348	36
α-helix	357-389	33
α-helix	391-401	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endothelin B receptor,Endolysin,Endothelin B receptor	A	protein	464	Homo sapiens, Enterobacteria phage T4	P00720, P24530 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5XPR_1 Endothelin B receptor,Endolysin,Endothelin B receptor (chains A)
GGGLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTL
LYIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQK
ASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDI
ITMDYKGSYLRICLLHPVQKTAFMQFYATAKDWWLFSFYFCLPLAITAFFYTLMTCEMLR
KNIFEMLRIDEGGGSGGDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMV
FQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLN
DHLKQRREVAKTVFCLVLVFALCWLPLHLARILKLTLYNQNDPNRCELLSFLLVLDYIGI
NMASLNSCANPIALYLVSKRFKNAFKSALCCWAQSPSSENLYFQ

Ligands and cofactors

ID	Name	Formula	Copies
K86	4-tert-butyl-N-[6-(2-hydroxyethyloxy)-5-(2-methoxyphenoxy)-2-pyrimidin-2-yl-pyr…	C27 H29 N5 O6 S	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

X-ray structures of endothelin ETB receptor bound to clinical antagonist bosentan and its analog. Shihoya, W., Nishizawa, T., Yamashita, K. et al. Nat Struct Mol Biol (2017) 24:758-764. DOI 10.1038/nsmb.3450 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…

Browse structure collections

About this viewer

MolViewer shows 5XPR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.